SecReT6
Protein ID: 162453257
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4981
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]6996626..6998110 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9FKS3
KEGG IDscl:sce4981
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-184, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|162453257|ref|YP_001615624.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MATETQAAGSAGVQTLEGGSLLDEILAETKMTPGDEGYEIAKRGVQAFISELVAPRREGEKVDKAFVDAL
IAEIDVKLSRQIDEILHNPSFQKLESAWRGLKFVIDRCDFRENVKVEMLNCSKEDLLADFEDAPEVPKSG
LYKIVYSAEFGQFGGKPVGAIIANYEFGPGPQDIALLQKCAAVATMSHAPFIAAAGPQFFGLKDFQGLPN
LKDLKALFEGPQYTKWNAFRETEDARYVGLVMPRFLLRLPFGANTVPVKAFNYEEDVVGKHDAYCWGNAT
YAFATRLADSFAKYRWCPNIIGPQAGGSVENLPLHQYEAMGEIQTKVPTEIMLTERREFELSEEGFIGLT
FRKDSDNACFFSANSAQKAKFFGQSDEGRAAEMNYRLGTQLPYMFIMCRIAHYLKVLQREQIGTWKERAD
LEKELNDWIGQYVADQDVVSAATRGRRPLRKARIIVTEVPGNAGWYKVDMQVRPHFKYMGAFFTLSLVGK
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c6998110-6996626 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGCGACGGAGACACAGGCCGCGGGGAGCGCGGGCGTCCAGACCCTCGAGGGGGGGTCGCTGCTCGACG
AGATCCTCGCCGAGACGAAGATGACGCCCGGCGACGAGGGGTACGAGATCGCCAAGCGGGGCGTGCAGGC
CTTCATCTCGGAGCTCGTCGCCCCGCGGCGCGAGGGCGAGAAGGTCGACAAGGCCTTCGTCGACGCGCTG
ATCGCGGAGATCGACGTCAAGCTGTCGCGGCAGATCGACGAGATCCTCCACAACCCGAGCTTCCAGAAGC
TCGAGTCCGCGTGGCGCGGCCTCAAGTTCGTCATCGACCGGTGTGACTTCCGCGAGAACGTCAAGGTCGA
GATGCTCAACTGCTCCAAGGAGGACCTCCTCGCCGATTTCGAGGACGCCCCCGAGGTGCCGAAGAGCGGC
CTCTACAAGATCGTCTACTCGGCCGAGTTCGGGCAGTTCGGCGGCAAGCCGGTCGGCGCGATCATCGCGA
ACTACGAGTTCGGCCCGGGCCCCCAGGACATCGCGCTCCTCCAGAAGTGCGCCGCGGTCGCGACGATGTC
GCACGCGCCCTTCATCGCGGCGGCCGGGCCGCAGTTCTTCGGCCTGAAGGACTTCCAGGGGCTGCCCAAC
CTGAAGGACCTCAAGGCGCTCTTCGAGGGGCCGCAGTACACGAAGTGGAACGCGTTCCGCGAGACCGAGG
ACGCGCGCTACGTCGGGCTCGTGATGCCGCGCTTCCTGCTCCGCCTGCCCTTCGGCGCCAACACCGTCCC
GGTGAAGGCGTTCAACTACGAGGAGGACGTGGTCGGCAAGCACGACGCGTACTGCTGGGGCAACGCGACG
TACGCGTTCGCCACCCGGCTCGCCGACAGCTTCGCCAAGTACCGCTGGTGTCCGAACATCATCGGCCCCC
AGGCGGGCGGCTCCGTGGAGAACCTGCCGCTCCACCAGTACGAGGCGATGGGCGAGATCCAGACGAAGGT
GCCGACCGAGATCATGCTCACCGAGCGGCGCGAGTTCGAGCTCTCCGAGGAGGGCTTCATCGGGCTCACG
TTCCGCAAGGACTCGGACAACGCCTGCTTCTTCTCGGCCAACTCCGCCCAGAAGGCGAAGTTCTTCGGGC
AGAGCGACGAGGGCAGGGCGGCCGAGATGAACTACCGGCTCGGCACGCAGCTGCCGTACATGTTCATCAT
GTGCCGCATCGCGCACTACCTGAAGGTGCTGCAGCGCGAGCAGATCGGTACGTGGAAGGAGCGCGCCGAT
CTCGAGAAGGAGCTCAACGACTGGATCGGCCAGTACGTCGCCGATCAGGACGTCGTCTCCGCGGCGACCC
GCGGGCGCAGGCCGCTCCGCAAGGCGCGCATCATCGTGACCGAGGTGCCGGGGAACGCCGGCTGGTACAA
GGTCGACATGCAGGTGCGCCCGCACTTCAAGTACATGGGCGCCTTCTTCACGCTGAGCCTCGTCGGCAAG
CTCGACAAGGAGTGA
 Primer design