SecReT6
Protein ID: 162453258
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4982
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]6998114..6998605 [-]
Producthypothetical protein
NoteTssB
UniProt IDA9FKS7
KEGG IDscl:sce4982
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-55, Aligned region: 4..157
Protein Sequence: 163 a.a.     [Download]
>gi|162453258|ref|YP_001615625.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MKEGSVAPKERVNITYKPATGNAKEDVELPLKLLMLGDYTQRPDPRPLEDRKPINVDKDNFQKVMSEQKL
ALTFNVKDVLSEQENSELTVNLKFRRLSDMEPEAIANQVPELKKLLDLRAALTALKGPLGNEKAFRNKIQ
QILSDPAQRNKIVSELGLDKEGE
 
Nucleotide Sequence: 492 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c6998605-6998114 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGAAAGAGGGATCGGTCGCGCCGAAAGAGCGCGTGAACATCACGTACAAGCCGGCCACCGGGAACGCGA
AGGAGGACGTCGAGCTGCCGCTGAAGCTCCTGATGCTCGGCGACTACACGCAGCGGCCGGATCCGCGGCC
CCTCGAGGACCGCAAGCCCATCAACGTGGACAAGGACAACTTCCAGAAGGTCATGAGCGAGCAGAAGCTC
GCGCTCACCTTCAACGTGAAGGACGTCCTGTCCGAGCAGGAGAACAGCGAGCTCACGGTCAACCTCAAGT
TCCGCCGGCTGAGCGACATGGAGCCCGAGGCGATCGCGAACCAGGTGCCGGAGCTCAAGAAGCTGCTCGA
CCTGCGCGCCGCGCTGACGGCCCTCAAGGGCCCGCTCGGAAACGAGAAGGCGTTCCGCAACAAGATTCAG
CAGATCCTGAGCGACCCGGCTCAGCGCAACAAGATCGTCAGCGAGCTCGGGCTCGACAAGGAAGGGGAGT
GA
 Primer design