SecReT6
Protein ID: 162453259
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4983
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]6998778..7000466 [-]
Producthypothetical protein
NoteTssA
UniProt IDA9FKT1
KEGG IDscl:sce4983
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-16, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 1.10E-16, Aligned region: 485..500
DUF2360 [PF10152], Evalue: 0.0047, Aligned region: 191..290
Protein Sequence: 562 a.a.     [Download]
>gi|162453259|ref|YP_001615626.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MAAEDAIQQSKERIEALYAPINGGVGADVTYDEAFEGLKNEVDKLQSLAGGKVDWGRIASVADELLSEKS
KDFRVALYYAAAKSQVDKLPGLLDGLVLVQELNNAFWDTMYPAIKRPKARGNLCAWFGDLAAGTLTGITV
TAADRDVVNAIDQVSRALDVDLADKLGDAYGGLGPLRNAIRSLVASLPAEAPPPPPPPPPPPPPPPPPPR
VEPPKAEPPPAATAAAAAPPPAPAPVAAAGDPALSLEAIVDEDSALAALGKCSPLMARAGDALRAADPKR
ASAYRILRVGLWVDLLDDPGASSPTGSTAIPPPPEHVLQTLPALTTQGAFADLLQVADEYAQSYPLWLDP
HRYVANALEQLGDDYADAKRAVLVEVGALLLRAPLLPTLKFSDGTPFADGETQAWLSSEVAAALGGAGAS
GAAAPARPRSYLDKPLSEARGLVANQQPIDAMALLEKAAAAAPTALDRFRVRLAMAQINIELSQFLVARA
QLEALEHLVDHHRLTTWQPDLCAELYAALHTCYRVLNQGYEATPEAKAKETLCFERVCQLDAALALKMSL
GE
 
Nucleotide Sequence: 1689 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c7000466-6998778 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGCCGCTGAAGACGCCATCCAACAATCCAAAGAGCGGATCGAGGCGCTGTACGCGCCCATCAACGGCG
GCGTCGGCGCCGACGTCACCTACGACGAGGCGTTCGAGGGCCTCAAGAACGAGGTCGACAAGCTGCAGTC
GCTCGCCGGCGGCAAGGTCGACTGGGGGCGCATCGCGAGCGTCGCGGATGAGCTCCTGAGCGAGAAGTCC
AAGGACTTCCGCGTCGCGCTCTACTACGCGGCGGCGAAGTCGCAGGTCGACAAGCTGCCCGGTCTGCTCG
ACGGGCTCGTGCTCGTGCAAGAGCTGAACAACGCGTTCTGGGACACCATGTATCCCGCGATCAAGCGGCC
CAAGGCGCGCGGCAACCTGTGCGCCTGGTTCGGAGACCTCGCGGCAGGGACGCTCACCGGCATCACCGTC
ACCGCCGCGGACCGCGACGTGGTGAACGCCATCGACCAGGTGAGCCGCGCCCTGGACGTCGACCTCGCCG
ACAAGCTCGGTGACGCGTACGGAGGGCTCGGCCCGCTCCGGAACGCGATCCGCAGCCTCGTCGCGAGCCT
GCCCGCGGAGGCGCCGCCTCCGCCGCCCCCTCCTCCTCCGCCGCCGCCCCCGCCGCCGCCTCCTCCGCGG
GTCGAGCCGCCGAAGGCCGAGCCGCCGCCGGCGGCCACGGCAGCGGCCGCGGCGCCGCCGCCCGCGCCTG
CGCCCGTCGCCGCCGCGGGCGATCCGGCGCTCAGCCTCGAGGCGATCGTCGACGAAGACTCCGCGCTCGC
CGCCCTCGGCAAGTGCTCGCCCCTGATGGCGCGCGCGGGCGACGCGCTGCGGGCGGCGGATCCGAAGCGG
GCGTCCGCGTACCGCATCCTCCGGGTCGGGCTCTGGGTCGACCTCCTCGACGATCCGGGCGCGTCGTCTC
CGACGGGCAGCACGGCGATCCCGCCGCCGCCCGAGCACGTGCTGCAGACGCTCCCGGCGCTCACGACCCA
GGGGGCGTTCGCCGATCTGCTGCAGGTCGCCGACGAGTACGCGCAGAGCTACCCCCTCTGGCTCGATCCG
CACAGGTACGTCGCGAACGCGCTCGAGCAGCTCGGCGACGACTACGCCGACGCCAAGCGGGCGGTGCTCG
TCGAGGTGGGCGCGCTGCTGCTCCGGGCGCCGCTCCTGCCGACCCTCAAGTTCAGCGACGGCACGCCGTT
CGCGGACGGCGAGACGCAGGCGTGGCTCTCGTCCGAGGTCGCCGCCGCGCTCGGCGGCGCGGGTGCGAGC
GGCGCCGCGGCCCCGGCGAGGCCCCGGAGCTACCTCGACAAGCCGCTCTCCGAGGCCCGAGGGCTCGTCG
CGAACCAGCAGCCCATCGACGCGATGGCGCTCCTCGAGAAGGCCGCCGCCGCGGCTCCGACGGCGCTGGA
CCGCTTCCGCGTGAGGCTCGCGATGGCCCAGATCAACATCGAGCTGTCCCAGTTCCTCGTGGCGCGGGCG
CAGCTCGAGGCGCTGGAGCACCTCGTCGACCACCACCGACTCACCACCTGGCAGCCGGATCTCTGCGCGG
AGCTCTACGCCGCGCTCCACACGTGCTACCGGGTCCTGAACCAGGGCTACGAGGCCACCCCCGAGGCCAA
GGCGAAGGAGACGCTCTGCTTCGAGCGCGTCTGCCAGCTCGACGCGGCGCTCGCCTTGAAGATGTCGCTG
GGGGAGTGA
 Primer design