SecReT6
Protein ID: 162453261
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4985
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7002168..7005884 [-]
Producthypothetical protein
NoteTssM
UniProt IDA9FKT9
KEGG IDscl:sce4985
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.80E-81, Aligned region: 63..98
ImcF-related_N [PF14331], Evalue: 5.80E-81, Aligned region: 184..449
IcmF-related [PF06761], Evalue: 1.30E-27, Aligned region: 65..118
IcmF-related [PF06761], Evalue: 1.30E-27, Aligned region: 500..832
IcmF-related [PF06761], Evalue: 1.30E-27, Aligned region: 918..989
DUF1215 [PF06744], Evalue: 3.00E-19, Aligned region: 66..80
DUF1215 [PF06744], Evalue: 3.00E-19, Aligned region: 961..1069
Protein Sequence: 1238 a.a.     [Download]
>gi|162453261|ref|YP_001615628.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MWLWILSALFLTAVWGVWFMLRPAAGEGAEAFPIEIPLVATAVVLAVLVGLAVYRRIRAARAARALEKAI
AQQAQEQVINAKPERRAEIQELNRQMQEGIAALKASKLGGGKRGADALYVLPWYVMVGPPGAGKTTALRH
SGLVFPYIDPERTGVRGVGGTRNCEWWFTNEAILLDTAGRYTTESDDHDEWMAFLETLLQHREHKPLNGV
IVAVSLSDLLDASDEQIDQTGKKIRARIDEMQQTLHMVLPVYVLFTKSDLVAGFTEYFGDLKKSERAQAW
GATVRLDENKDEPGKIFDREFDVLVEKLHARLTKRLIGERNREVKEKSYQFPLEFAAVKRNLSDFIAAAF
APKAGAAPTPILRGFYFTSGVQEGRPLDRVVGAMGRAFGLRAGLGEGEEDAAIPKESKSFFLHDVFTNVV
FPDQDLAARSEAELRRRRMQRILVAAAAALVALLFLLPAVISYFNNKGLVAETRRISDEIAFVDWSGRSG
APPNVRANIDKLDRLQEHVGRLDGYVENTPIEYGWFMFQGDKLFPPTMGQYIMSLKQGFVSPAKAQLEAK
LEKVREGEFLDGYNALRSYLLLGKEYQGHMDEQAARWQTGRLVQVWADTLKPFTDLPESELKERLTPHVA
YYIDLVRRKKLEAEELNEPLIARARADLLRVDPTKRYYDQFVTSLIDQKYDESGPNTPENLKYPPVSLNE
MFADRPEVLTVVHSAQKNRGGTWFEVQGPYTAKGHAQVLESLKEGRKKLERELWVLPLSSDEKRQGDQIQ
KELDRVRQDYDNAYIAQWEAFFRDIQVDVPKTNRDAIHEFRVLSTPDWPYRRLLQRLSDETQFGKDEKPS
LLTADGGLLDRAKDMIAQKVDQRTGVRIDSMLTGNQRQHYDPVPDKFESMASFGVPQPPAGEGQPPPPPP
KLGQYVGHLERLAGEMSVVEDGPPDADTSKATEAFQDAVKETQGLLLSMDQTGQRLMEPLLMNPLRQAYK
AVVRRAGGAASGIWEVEVWPHYRDKIKDRYPFNLASSRDASLEDAMAFFKPKDGVLWGFYETYLKGFHYQ
VGHEFFPKAHLSGQPQAAKPFTPFSANLYNCLRRSNEISDALFGSSGGAEPKVVFHINMKTVSPIVSEVV
FEVDGQKRLYRNEKEFWHTFNWPGEGAKGARIQVRGAGGLDEELVREGPWGIFRLFEAGTTTAQKDNDEL
FTVTWQMTAPPVTVTMEIRPTRGNHPFPTSFFRATNCPASIGDRFGKG
 
Nucleotide Sequence: 3717 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c7005884-7002168 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGTGGCTGTGGATCCTGAGCGCCCTGTTCCTCACCGCCGTGTGGGGAGTGTGGTTCATGCTGCGCCCGG
CGGCAGGGGAGGGGGCCGAGGCGTTCCCGATCGAGATCCCGCTCGTGGCGACGGCGGTCGTCCTCGCCGT
GCTCGTCGGGCTGGCGGTCTACCGGCGCATCCGCGCGGCGCGCGCCGCGCGGGCGCTCGAGAAGGCGATC
GCGCAGCAGGCGCAGGAGCAGGTGATCAACGCGAAGCCGGAGCGGCGCGCGGAGATCCAGGAGCTCAACC
GGCAGATGCAGGAGGGCATCGCCGCGCTCAAGGCCTCGAAGCTCGGCGGGGGCAAGCGGGGCGCCGACGC
GCTCTACGTCCTCCCCTGGTACGTGATGGTCGGCCCGCCCGGGGCAGGCAAGACCACCGCCCTCCGGCAC
TCCGGGCTCGTGTTCCCGTACATCGACCCCGAGCGCACCGGCGTGCGCGGCGTCGGCGGCACCAGGAACT
GCGAGTGGTGGTTCACGAACGAGGCGATCCTCCTCGACACAGCCGGCCGGTACACGACCGAGAGCGACGA
CCACGACGAGTGGATGGCGTTCCTCGAGACCCTGCTGCAGCACCGCGAGCACAAGCCGCTGAACGGCGTC
ATCGTCGCGGTGAGCCTGAGCGATCTGCTCGACGCGAGCGACGAGCAGATCGATCAGACCGGCAAGAAGA
TCCGCGCGCGCATCGACGAGATGCAGCAGACGCTGCACATGGTCCTGCCGGTCTACGTGCTCTTCACGAA
GAGCGACCTGGTGGCGGGCTTCACCGAGTACTTCGGCGACCTGAAGAAGAGCGAGCGCGCCCAGGCGTGG
GGCGCCACCGTGCGGCTCGACGAGAACAAGGACGAGCCCGGGAAGATCTTCGATCGCGAGTTCGACGTGC
TCGTCGAGAAGCTCCACGCGCGCCTGACGAAGCGGCTCATCGGCGAGCGCAACCGCGAGGTGAAGGAGAA
GAGCTACCAGTTCCCGCTCGAGTTCGCGGCGGTGAAGCGCAACCTGTCGGACTTCATCGCGGCGGCGTTC
GCGCCCAAGGCGGGCGCGGCGCCCACGCCGATCCTGCGCGGGTTCTACTTCACGAGCGGCGTGCAGGAGG
GGCGGCCGCTCGATCGCGTGGTCGGGGCGATGGGGCGCGCGTTCGGGCTCCGCGCCGGGCTCGGCGAGGG
TGAGGAGGACGCCGCGATCCCGAAGGAGTCGAAGAGCTTCTTCCTGCACGACGTGTTCACCAACGTCGTC
TTCCCGGATCAGGACCTCGCCGCGCGCTCCGAGGCGGAGCTCCGGCGGCGGCGGATGCAGCGGATCCTGG
TGGCCGCGGCCGCGGCGCTCGTGGCGCTCCTGTTCCTCCTGCCGGCGGTCATCTCGTACTTCAACAACAA
GGGGCTCGTCGCCGAGACCCGGCGCATCTCGGACGAGATCGCGTTCGTGGACTGGTCGGGGCGGAGCGGC
GCGCCGCCGAACGTGCGCGCGAACATCGACAAGCTCGATCGGCTGCAGGAGCACGTGGGGCGGCTCGACG
GTTACGTCGAGAACACGCCGATCGAGTACGGCTGGTTCATGTTCCAGGGGGACAAGCTGTTCCCGCCGAC
GATGGGCCAGTACATCATGAGCTTGAAGCAGGGCTTCGTCAGCCCTGCGAAGGCGCAGCTCGAGGCGAAG
CTCGAGAAGGTGCGCGAGGGGGAGTTCCTGGACGGCTACAACGCCCTGCGGAGCTACCTCCTGCTCGGCA
AGGAGTACCAGGGCCACATGGATGAGCAGGCGGCGCGGTGGCAGACCGGGCGGCTCGTCCAGGTCTGGGC
CGACACGCTGAAGCCGTTCACCGATCTGCCCGAGAGCGAGCTGAAGGAGCGGCTCACGCCGCACGTCGCG
TACTACATCGACCTCGTGCGGCGGAAGAAGCTCGAGGCCGAGGAGCTGAACGAGCCGCTCATCGCCCGGG
CGCGCGCCGACCTGCTGCGGGTCGACCCGACGAAGCGCTACTACGATCAATTTGTAACGAGCCTGATCGA
TCAGAAGTACGACGAGTCGGGGCCGAACACGCCGGAGAACCTGAAGTACCCGCCGGTGTCGCTCAACGAG
ATGTTCGCGGATCGGCCCGAGGTGCTGACCGTCGTCCACAGCGCGCAGAAGAACCGGGGCGGGACGTGGT
TCGAGGTGCAGGGGCCCTACACGGCCAAGGGGCACGCGCAGGTGCTCGAGTCGCTGAAGGAGGGGAGGAA
GAAGCTCGAGCGCGAGCTCTGGGTGCTCCCCCTGTCGAGCGACGAGAAGCGGCAGGGCGACCAGATCCAG
AAGGAGCTCGACCGCGTCCGGCAGGACTACGACAACGCGTACATCGCGCAGTGGGAGGCGTTCTTCCGCG
ACATCCAGGTCGACGTCCCGAAGACGAACCGGGACGCGATCCACGAGTTCAGGGTGCTCTCCACGCCCGA
CTGGCCCTACCGGCGGCTGCTCCAGCGGCTCTCGGACGAGACGCAGTTCGGGAAGGACGAGAAGCCGAGC
CTGCTGACGGCGGACGGCGGCCTGCTCGACCGGGCCAAGGACATGATCGCGCAGAAGGTCGACCAGCGGA
CGGGCGTGCGGATCGACTCGATGCTCACGGGGAACCAGCGCCAGCACTACGATCCGGTGCCTGACAAGTT
CGAGTCGATGGCCAGCTTCGGGGTGCCCCAGCCGCCGGCGGGCGAAGGGCAGCCCCCGCCGCCCCCGCCC
AAGCTCGGCCAGTACGTGGGCCACCTCGAGCGGCTGGCAGGGGAGATGAGCGTCGTCGAGGACGGGCCGC
CGGACGCGGACACCTCGAAGGCCACGGAGGCGTTCCAGGACGCGGTGAAGGAGACGCAGGGGCTGCTGCT
CTCGATGGACCAGACCGGGCAGCGGCTGATGGAGCCGCTCCTCATGAACCCCCTCCGGCAGGCGTACAAG
GCCGTCGTGCGGCGCGCGGGCGGCGCGGCGAGCGGGATCTGGGAGGTCGAGGTCTGGCCGCACTACCGCG
ACAAGATCAAGGACCGCTACCCGTTCAACCTCGCGTCGTCACGGGACGCGTCGCTCGAGGACGCGATGGC
CTTCTTCAAGCCGAAGGACGGGGTGCTCTGGGGCTTCTACGAGACGTACCTCAAGGGCTTCCACTACCAG
GTCGGGCACGAGTTCTTCCCGAAGGCGCACCTCTCGGGGCAGCCGCAGGCGGCGAAGCCGTTCACGCCGT
TCAGCGCGAACCTGTACAACTGCCTGAGGCGCTCGAACGAGATCTCCGACGCGCTCTTCGGGAGCAGCGG
CGGGGCGGAGCCGAAGGTCGTCTTCCACATCAACATGAAGACGGTCAGCCCGATCGTGAGCGAGGTGGTC
TTCGAGGTCGACGGCCAGAAGAGGCTCTATCGCAACGAGAAAGAGTTCTGGCACACCTTCAACTGGCCGG
GCGAAGGCGCGAAGGGGGCGAGGATCCAGGTGCGCGGCGCGGGGGGGCTCGACGAGGAGCTCGTGCGCGA
AGGGCCGTGGGGGATCTTCCGGCTCTTCGAGGCCGGGACGACCACCGCCCAGAAGGACAACGACGAGCTG
TTCACGGTGACCTGGCAGATGACGGCGCCGCCGGTGACCGTGACCATGGAGATCAGGCCGACCCGGGGGA
ACCACCCGTTCCCGACGAGCTTCTTCCGGGCGACCAACTGCCCTGCCAGCATCGGCGATCGCTTCGGTAA
AGGGTGA
 Primer design