SecReT6
Protein ID: 162453262
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4986
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7005926..7006603 [-]
Producthypothetical protein
NoteTssL
UniProt IDA9FKU2
KEGG IDscl:sce4986
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.40E-42, Aligned region: 10..204
Protein Sequence: 225 a.a.     [Download]
>gi|162453262|ref|YP_001615629.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MSLSQTMYFVCSDVLSLILQLRNSRDLPAPDILQRRVLGLFDTMMQNGREARIPEQDMIDAKFALAAFAD
EVIFNSNWPGRTQWLQNPLQFQFFQLNTAGDGFFTNLDNLYGQRGRNHVAQIYFLCLALGFQGKYRLRQQ
EGLGAVIEGVGNHVAVAEGGGEVLAPNAERKDGGANAVRRELPYLAIALGLLVLAVLVVIVLRLVVASDA
EGVADQIKKLISTGT
 
Nucleotide Sequence: 678 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c7006603-7005926 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGAGCCTCTCGCAGACGATGTACTTTGTGTGCTCCGACGTGCTCTCGCTGATCCTGCAGCTCAGGAACT
CGCGCGACCTCCCGGCGCCCGACATCCTCCAGCGGCGCGTCCTCGGCCTGTTCGACACGATGATGCAGAA
CGGCCGGGAGGCGCGCATCCCCGAGCAGGACATGATCGACGCGAAGTTCGCGCTCGCGGCCTTCGCCGAC
GAGGTGATCTTCAACTCGAACTGGCCGGGGAGGACGCAGTGGCTCCAGAACCCGCTGCAGTTCCAGTTCT
TCCAGCTGAACACGGCCGGCGACGGGTTCTTCACGAACCTCGACAACCTCTACGGCCAGCGCGGGAGGAA
CCACGTCGCGCAAATCTACTTCCTCTGCTTGGCCCTCGGCTTCCAGGGGAAATATCGTCTGCGCCAGCAG
GAGGGCCTCGGCGCCGTCATCGAGGGCGTGGGCAACCACGTCGCTGTCGCCGAGGGCGGCGGTGAGGTCC
TCGCGCCGAACGCGGAGCGCAAGGACGGCGGGGCGAACGCGGTTCGCCGCGAGCTGCCCTACCTGGCCAT
CGCGCTCGGGCTGCTCGTGCTGGCCGTCCTCGTGGTCATCGTGCTCCGGCTCGTCGTGGCCTCGGACGCG
GAGGGCGTGGCCGACCAGATCAAGAAGCTGATCAGCACGGGGACCTAG
 Primer design