SecReT6
Protein ID: 162453263
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4987
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7006638..7007999 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9FKU6
KEGG IDscl:sce4987
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-102, Aligned region: 19..449
Protein Sequence: 453 a.a.     [Download]
>gi|162453263|ref|YP_001615630.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MIHPRKPVWTEGLFMTPQHLQQTDAYHETLLHARLHAVVGYDWGITSAQFDERALSAGQFKVVKCHGVFP
DGTPFFIGDRGEDQVEARPLEGAFPAALKTLDVFLGIPNLRETAANISLDPAKAGPAQRFVAAQTTVPDV
NSGRNEQSVTWARTNLRLLFGTEPRDAYQTVRIAQLVRDSSGAIALRKSFIPSVLRINTSDHIMSGLRRV
LSALVGKQKSLVEGRRMRNAASVDFQASDLTKFWLLHTLNSYIPIVSHLVDHGGAHPEQCYVVLGSLIGE
LCTFAATDSDPTTIPKFNYLELDGVLDPMFDRAWRLINEVVTEQFVIVPLEKREDGMYLGRFEDPKLPRS
HEMFLEAKGTDEGTLRERLPRLLKIGSWTQIGHILHSATPGVNVAIEYRPPGAIPVKPGLVYLRVNQNGD
YWNDILGSGTIAIYQPIEPQKVDLRLIAVPAGK
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c7007999-7006638 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGATTCACCCGCGCAAGCCGGTCTGGACCGAGGGGCTCTTCATGACCCCTCAGCACCTGCAGCAAACGG
ACGCCTACCACGAGACGCTGCTCCACGCGCGCCTCCATGCCGTCGTGGGCTACGACTGGGGCATCACGTC
CGCCCAGTTCGATGAGCGCGCGCTCTCCGCCGGGCAGTTCAAGGTCGTCAAATGCCACGGCGTCTTCCCC
GACGGCACGCCGTTCTTCATCGGCGATCGCGGCGAAGACCAGGTCGAGGCGCGCCCGCTCGAGGGCGCCT
TCCCGGCCGCGTTGAAGACGCTCGACGTCTTCCTCGGCATCCCGAACCTGCGCGAGACCGCGGCGAACAT
CAGCCTGGACCCGGCGAAGGCGGGCCCCGCCCAGCGGTTCGTGGCCGCCCAGACGACGGTCCCGGACGTG
AACTCCGGCCGCAACGAGCAGTCGGTCACCTGGGCCCGCACCAACCTGCGGCTCCTCTTCGGCACCGAGC
CGCGCGACGCATACCAGACCGTGCGCATCGCGCAGCTCGTCCGCGACAGCTCCGGCGCGATCGCCCTGCG
GAAGAGCTTCATCCCGTCGGTCCTCCGCATCAACACGTCGGACCACATCATGTCCGGCCTCCGCCGCGTG
CTCTCGGCGCTCGTCGGCAAGCAGAAGTCGCTCGTCGAGGGGCGGCGCATGCGCAACGCGGCGTCGGTCG
ACTTCCAGGCCTCCGACCTCACCAAGTTCTGGCTGCTCCACACCCTGAACTCGTACATCCCGATCGTGTC
GCACCTCGTCGACCACGGCGGCGCGCACCCGGAGCAGTGTTATGTCGTCCTCGGCTCGCTCATCGGAGAG
CTCTGCACCTTTGCGGCCACCGACAGCGATCCGACGACGATCCCCAAGTTCAACTACCTCGAGCTCGATG
GCGTCCTCGACCCGATGTTCGACCGGGCCTGGAGGCTCATCAACGAGGTTGTCACGGAGCAGTTCGTCAT
CGTGCCGCTCGAGAAGCGCGAGGACGGCATGTACCTCGGCAGGTTCGAGGACCCGAAGCTGCCCCGCAGC
CACGAGATGTTCCTCGAGGCGAAGGGCACGGACGAGGGCACGCTGCGCGAGCGGCTCCCGCGCCTGCTCA
AGATCGGCTCGTGGACGCAGATCGGCCACATCCTGCACTCCGCGACGCCCGGCGTGAACGTCGCCATCGA
GTACCGGCCGCCGGGCGCCATCCCGGTCAAGCCGGGGCTCGTCTACCTCCGCGTCAACCAGAACGGCGAT
TACTGGAACGATATCCTCGGCTCTGGCACGATCGCTATCTACCAGCCGATCGAACCGCAAAAGGTCGATC
TCCGGCTGATCGCCGTCCCGGCAGGAAAGTGA
 Primer design