SecReT6
Protein ID: 162453264
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4988
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7008181..7008972 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA9FKU9
KEGG IDscl:sce4988
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-32, Aligned region: 68..195
Protein Sequence: 263 a.a.     [Download]
>gi|162453264|ref|YP_001615631.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MVPFAKLLQRSMWIGEPRSPSPAGEGSARQPGPRRRPASLLRGVAPAKVAAAIAAATFAAFLGAALPAAL
SGCTSAAPPPAAPEPCDVQIVTLSIYASDNINPNENGNPRPVVVRLYQLKSSARMENATYDQILLKDKET
LEDDLAKVDEVEVFPNDLVEVKFERLPDASHLVGAALFHSPKGNSWKTFYEFPLPPGEAQCGGREADAGP
PVADPRVAFFIDSTKIDNGVEFDESMFPNASAVRRLSLPKKVAAPEAPARPGK
 
Nucleotide Sequence: 792 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c7008972-7008181 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGTCCCGTTCGCCAAGCTCCTACAGCGTTCGATGTGGATCGGGGAGCCCCGTTCGCCCTCCCCCGCAG
GGGAGGGCTCGGCGCGCCAGCCGGGGCCTCGACGTCGGCCGGCGTCGCTCCTCCGCGGGGTGGCCCCGGC
GAAGGTCGCGGCGGCCATCGCCGCGGCGACCTTCGCCGCCTTCCTCGGCGCCGCGCTGCCCGCCGCGCTC
TCGGGCTGCACGTCCGCCGCGCCGCCGCCCGCGGCCCCCGAGCCGTGCGACGTCCAGATCGTGACGCTCT
CGATCTACGCGTCCGACAACATCAACCCCAACGAGAACGGGAACCCCCGGCCCGTGGTCGTGCGGCTCTA
CCAGCTGAAGAGCAGCGCGCGCATGGAGAACGCGACATACGACCAGATCCTCCTCAAGGACAAGGAGACG
CTCGAGGACGACCTCGCCAAGGTCGACGAGGTCGAGGTCTTCCCGAACGACCTCGTCGAGGTGAAGTTCG
AGCGCCTGCCCGACGCGAGCCACCTCGTCGGCGCCGCCCTGTTCCACAGCCCGAAGGGCAACAGCTGGAA
GACCTTCTACGAGTTCCCGCTCCCGCCCGGAGAGGCGCAGTGCGGCGGCCGCGAGGCCGACGCAGGTCCG
CCCGTGGCCGATCCGCGGGTCGCGTTCTTCATCGACTCGACCAAGATCGACAACGGGGTCGAGTTCGACG
AGTCGATGTTCCCCAACGCGAGCGCCGTTCGCCGGCTCAGCCTGCCGAAGAAGGTGGCCGCGCCGGAGGC
GCCCGCTCGCCCGGGGAAGTGA
 Primer design