SecReT6
Protein ID: 162453265
SecReT6 ID248
T6SS typei1
Gene symbolclpA
Locus tagsce4989
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7009076..7011781 [-]
Productendopeptidase Clp
NoteTssH
UniProt IDA9FKV2
KEGG IDscl:sce4989
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.50E-42, Aligned region: 233..255
AAA_2 [PF07724], Evalue: 9.50E-42, Aligned region: 492..525
AAA_2 [PF07724], Evalue: 9.50E-42, Aligned region: 622..797
AAA [PF00004], Evalue: 3.20E-17, Aligned region: 235..352
AAA [PF00004], Evalue: 3.20E-17, Aligned region: 521..550
AAA [PF00004], Evalue: 3.20E-17, Aligned region: 627..753
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 48..81
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 212..252
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 507..544
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 611..637
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 690..720
AAA_16 [PF13191], Evalue: 2.30E-13, Aligned region: 793..838
ClpB_D2-small [PF10431], Evalue: 5.30E-12, Aligned region: 475..501
ClpB_D2-small [PF10431], Evalue: 5.30E-12, Aligned region: 806..877
AAA_5 [PF07728], Evalue: 6.50E-12, Aligned region: 235..255
AAA_5 [PF07728], Evalue: 6.50E-12, Aligned region: 626..747
AAA_22 [PF13401], Evalue: 3.50E-07, Aligned region: 234..326
AAA_22 [PF13401], Evalue: 3.50E-07, Aligned region: 623..640
AAA_22 [PF13401], Evalue: 3.50E-07, Aligned region: 687..720
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 235..261
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 296..333
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 467..547
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 606..652
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 213..249
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 293..327
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 513..542
Arch_ATPase [PF01637], Evalue: 2.40E-06, Aligned region: 622..638
Clp_N [PF02861], Evalue: 5.80E-06, Aligned region: 34..78
Clp_N [PF02861], Evalue: 5.80E-06, Aligned region: 327..337
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 235..262
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 436..470
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 626..651
IstB_IS21 [PF01695], Evalue: 4.90E-05, Aligned region: 218..255
IstB_IS21 [PF01695], Evalue: 4.90E-05, Aligned region: 626..644
IstB_IS21 [PF01695], Evalue: 4.90E-05, Aligned region: 736..749
Sigma54_activat [PF00158], Evalue: 9.00E-05, Aligned region: 217..249
Sigma54_activat [PF00158], Evalue: 9.00E-05, Aligned region: 605..742
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 229..258
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 622..639
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 224..252
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 611..637
AAA_23 [PF13476], Evalue: 0.0051, Aligned region: 235..265
AAA_23 [PF13476], Evalue: 0.0051, Aligned region: 480..518
AAA_23 [PF13476], Evalue: 0.0051, Aligned region: 623..649
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 235..254
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 436..494
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 627..650
Protein Sequence: 901 a.a.     [Download]
>gi|162453265|ref|YP_001615632.1| clpA gene product [Sorangium cellulosum 'So ce 56']
MPRMQLVDTKAIVKRLTKNCTSALEAAIGQCVNARHYEVTLEHLLLALLDDANSDIAFLVSHYDLDPSHL
RAALQRSLEELRKGNAGRPVLSPTMLEWMQDAYLVGSMEYGYQRVRSGVLFQRLVQQPTRYSVSSIGAYL
EGISKDDLKNNLPKIVSGSKEEAEAAAAAAGAGAPGAGKLPAGMASAGPDSALAKFCVDYTGKARAGQID
PIFGREREIRQVIDILARRRKNNPIIVGDAGVGKTALVEGLALLIVESTPENPKVPPLLQGVDILGLDMG
LLQAGAGVKGEFENRMKQVIAEVKGSSKPIILFIDEAHTLIGAGGQQGGGDAANLLKPALARGELRTIAA
TTWSEYKKYFEKDAALERRFQPVKVDEPSEPAAVVMLRGLRPKFEVAHNVIIQDEAVTAAVRLSARYLTG
RQLPDKAVDLLDTCAARVKVALQQRPSAVEDAEILIVNTETELKALERDRDRGVHIDEERVSALKDRLAK
AKTELETVRAAYAKETAGTQRVIDARKKMDEAKTSEERDAARREVVKALDELKQSQGEVPLVRPDVDEAM
VASVVAAWTGIPVGKMVQDDVKALLEMEDRLTRRIKGQTHGIVTISKELRSARAGLKPLSTPQGVFLLVG
PSGVGKTETALGIADLMFGGERMMTVINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPYTVVL
LDEVEKADPDVMNLFYQVFDKGMLSDGEGRLVDFKNTVIILTSNLATDKITNMTVAAREEDPSRRLDADG
EFIKEIVESIKPTLSAHFKPALLARMTTVPYLPISPDALGEITRLKLDALVDRLRKSQRIEASYSDALVE
TIAARCTEVDTGARNIDHILRASLLPLLSVAVLEKMAEGPLPKRLQIGVDAEKNFTISFSD
 
Nucleotide Sequence: 2706 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c7011781-7009076 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGCCGCGCATGCAGCTCGTCGACACCAAAGCCATCGTCAAGCGACTCACCAAGAACTGCACCTCTGCCC
TCGAGGCGGCGATTGGCCAGTGTGTCAACGCGCGCCACTACGAGGTCACGCTCGAGCACCTGCTCCTCGC
GCTGCTCGACGACGCGAACTCCGACATCGCGTTTCTCGTATCCCACTATGATCTCGACCCGTCGCACCTC
CGCGCCGCGCTCCAGCGCAGCCTGGAAGAGCTGAGGAAGGGCAACGCCGGGAGGCCCGTGCTCTCGCCGA
CGATGCTCGAGTGGATGCAGGACGCCTATCTCGTCGGATCCATGGAGTACGGCTACCAGCGGGTCCGGAG
CGGCGTGCTCTTCCAGCGCCTCGTCCAGCAGCCGACCCGGTACTCGGTGAGCAGCATCGGCGCGTATCTC
GAGGGCATCTCGAAAGACGATCTCAAGAACAACCTCCCCAAGATCGTCTCCGGCTCCAAGGAGGAGGCGG
AGGCCGCAGCCGCTGCGGCGGGCGCAGGAGCGCCCGGGGCCGGGAAGCTGCCGGCCGGGATGGCGAGCGC
CGGGCCCGATTCGGCGCTGGCGAAGTTCTGCGTCGACTACACGGGGAAGGCGCGCGCGGGGCAGATCGAT
CCGATCTTCGGCCGCGAGCGGGAGATCCGGCAGGTCATCGATATCCTCGCGCGGCGGCGCAAGAACAACC
CGATCATCGTCGGCGACGCGGGCGTCGGGAAGACGGCGCTCGTCGAGGGGCTCGCGCTGCTCATCGTCGA
GAGCACGCCGGAGAACCCGAAGGTGCCGCCGCTCCTGCAGGGCGTCGACATCCTCGGGCTCGACATGGGG
CTGCTCCAGGCAGGGGCCGGCGTGAAGGGCGAGTTCGAGAACCGGATGAAGCAGGTGATCGCCGAGGTGA
AGGGGTCGTCGAAGCCGATCATCCTCTTCATCGACGAGGCGCACACGCTCATCGGCGCGGGCGGCCAGCA
AGGCGGCGGCGATGCGGCCAACCTGCTCAAGCCGGCGCTCGCCCGCGGCGAGCTCCGGACGATCGCAGCC
ACGACGTGGAGCGAGTACAAGAAATACTTCGAGAAGGACGCGGCCCTGGAGCGGCGCTTCCAGCCGGTGA
AGGTCGACGAGCCGAGCGAGCCGGCGGCCGTCGTCATGCTCCGGGGGCTCCGGCCGAAGTTCGAGGTGGC
CCACAACGTCATCATCCAGGATGAGGCGGTGACCGCGGCCGTGCGGCTGTCGGCGCGCTACCTGACCGGC
AGGCAGCTGCCGGACAAGGCGGTCGACCTGCTCGACACCTGCGCGGCCCGCGTGAAGGTCGCGCTGCAGC
AGCGCCCCTCCGCGGTCGAGGACGCCGAGATCCTCATCGTGAACACCGAGACCGAGCTCAAGGCACTCGA
GCGGGATCGCGACAGGGGCGTGCACATCGATGAAGAGCGGGTCAGCGCGCTGAAGGACAGGCTCGCGAAG
GCGAAGACCGAGCTCGAGACGGTGCGCGCCGCGTACGCGAAGGAGACGGCGGGCACGCAGCGGGTCATCG
ACGCCCGCAAGAAGATGGACGAGGCCAAGACGAGCGAGGAGCGCGACGCCGCGCGCCGTGAGGTGGTCAA
GGCCCTCGACGAGCTCAAGCAGAGCCAGGGCGAGGTGCCGCTGGTCCGGCCGGACGTCGACGAGGCCATG
GTCGCGAGCGTGGTCGCGGCGTGGACGGGCATCCCCGTCGGCAAGATGGTCCAGGACGACGTGAAGGCGC
TCCTCGAGATGGAGGACCGGCTGACCCGGCGGATCAAGGGGCAGACGCACGGTATCGTGACGATCTCGAA
GGAGCTCCGGAGCGCGCGCGCGGGCCTGAAGCCGCTGAGCACGCCGCAGGGCGTGTTCCTGCTCGTGGGG
CCCAGCGGCGTCGGCAAGACGGAGACCGCGCTCGGGATCGCCGACCTCATGTTCGGCGGAGAGCGGATGA
TGACGGTCATCAACATGTCCGAGTTCCAGGAGAAGCACACCGTCTCCCGGCTCATCGGCTCGCCCCCCGG
CTACGTCGGCTACGGCGAGGGCGGCATGCTCACCGAGGCCGTGCGCCAGCGGCCCTACACGGTGGTGCTC
CTCGACGAGGTCGAGAAGGCCGACCCCGACGTGATGAACCTGTTCTACCAGGTGTTCGACAAGGGCATGC
TGAGCGACGGCGAGGGGCGGCTCGTCGACTTCAAGAACACGGTCATCATCCTGACGAGCAACCTCGCGAC
CGACAAGATCACGAACATGACGGTCGCGGCGCGGGAGGAAGACCCGTCGCGCCGCCTCGACGCGGACGGC
GAGTTCATCAAGGAGATCGTCGAGTCGATCAAGCCGACGCTCTCCGCGCACTTCAAGCCGGCGCTGCTCG
CGCGCATGACGACGGTGCCGTACCTGCCGATCTCGCCCGACGCGCTCGGCGAGATCACGCGGCTCAAGCT
CGACGCGCTCGTCGACCGCCTGCGCAAGAGCCAGCGGATCGAGGCGTCGTACTCGGACGCGCTCGTCGAG
ACGATCGCGGCGCGCTGCACCGAGGTCGACACGGGGGCGCGCAACATCGACCATATCCTCCGGGCGTCGC
TCCTGCCGCTGCTCTCGGTCGCCGTCCTCGAGAAGATGGCGGAGGGGCCGCTCCCGAAGCGGCTCCAGAT
CGGGGTCGACGCCGAGAAGAACTTCACGATCTCGTTCTCGGACTGA
 Primer design