SecReT6
Protein ID: 162453267
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4991
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7013910..7015202 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA9FKW1
KEGG IDscl:sce4991
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 9.00E-13, Aligned region: 27..93
Protein Sequence: 430 a.a.     [Download]
>gi|162453267|ref|YP_001615634.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MPAALSARVSDTQANQSFDVSFERFPVRIGRNQLNDLHIDRPYISQFHAAVDVRDRRIFVRDLGSTNGTM
FAGHRLARDTSVDVTGQPEITIGPIQIRLAIIEAPLKSESPNDGTLLGTGGDNLSALISPQKRAAPGGED
PYLRQVVPYLEAYRTAWAAVYRMIWDHLARLPPDARQSYLRRLGEEHPSVLAERDFQKISQYYGVDYRTL
GELAPANAAFAALSELAGALAPGAKPPDDVAGIVNFARRLRDTMEVFLKCFVSLRDGYQEFEAEVLDRDL
SAETDKVSNAKDAKELGTVLLTPVGGPDAARHLHEIFVDVMSHQLALLNGVMGGVRSLLVKLSPKTLEEK
LERVGKKGGLFSNKYEELWKLYERRHGDYSGEDKETFREIFGEQFSRAYAATAAEDYGSSGESGGRSIVR
FPGSGNPNKR
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|162448269|ref|NC_010162.1|:7013910-7015202 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGCCGGCGGCGCTCTCGGCCCGCGTGTCCGACACCCAGGCCAACCAAAGCTTCGACGTTTCGTTCGAGC
GCTTCCCTGTCCGGATCGGCAGGAATCAGCTGAACGACCTTCACATCGACCGGCCCTACATCTCCCAGTT
CCATGCGGCGGTGGACGTCCGCGATCGCCGGATCTTCGTGCGCGACCTCGGCTCCACGAACGGGACGATG
TTCGCGGGGCACCGGCTGGCGCGCGACACCTCGGTGGACGTGACCGGCCAGCCGGAGATCACGATCGGCC
CGATCCAGATCCGGCTCGCGATCATCGAGGCGCCGCTGAAGTCCGAGAGCCCGAACGACGGCACGCTGCT
CGGCACGGGCGGAGACAACCTCTCCGCGCTGATCAGCCCGCAGAAGCGCGCCGCTCCCGGCGGTGAAGAC
CCCTACCTGCGTCAGGTGGTCCCGTACCTGGAGGCGTACCGGACCGCGTGGGCCGCGGTCTACCGGATGA
TCTGGGATCACCTCGCGCGCCTCCCGCCCGACGCGCGCCAGAGCTACTTGCGCCGGCTCGGCGAGGAGCA
CCCGAGCGTGCTCGCGGAGCGGGATTTTCAGAAGATCTCCCAGTACTACGGCGTGGACTACCGCACGCTC
GGCGAGCTGGCCCCCGCGAACGCGGCGTTCGCCGCGCTCTCCGAGCTGGCGGGCGCCCTCGCGCCCGGCG
CGAAGCCCCCGGACGACGTCGCGGGCATCGTCAATTTCGCGCGGCGGCTCCGCGACACGATGGAGGTCTT
CCTGAAGTGCTTCGTGAGCTTGCGCGACGGCTATCAGGAGTTCGAGGCCGAGGTACTGGATCGCGATCTC
TCCGCGGAGACGGACAAGGTCTCGAACGCGAAGGACGCGAAGGAGCTCGGCACGGTGCTGCTCACGCCGG
TCGGGGGCCCGGACGCCGCGCGCCACCTCCACGAGATCTTCGTGGATGTCATGAGCCACCAGCTCGCGCT
CCTGAACGGCGTGATGGGGGGCGTGAGGTCGCTGCTCGTGAAGCTCTCCCCGAAGACGCTCGAGGAGAAG
CTCGAGCGCGTGGGCAAGAAAGGCGGGCTGTTCTCGAACAAGTACGAGGAGCTCTGGAAGCTCTACGAGC
GCCGCCACGGCGACTATTCGGGGGAGGACAAGGAGACGTTTCGGGAAATATTTGGCGAGCAGTTCTCTCG
GGCGTACGCTGCGACCGCCGCGGAGGACTATGGGTCGTCCGGCGAGTCGGGAGGCCGGAGCATCGTCCGC
TTCCCCGGCTCTGGGAATCCGAACAAACGCTAG
 Primer design