SecReT6
Protein ID: 162453270
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4994
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7017795..7018307 [+]
Producthypothetical protein
NoteTssD
UniProt IDA9FKX1
KEGG IDscl:sce4994
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-33, Aligned region: 7..152
Protein Sequence: 170 a.a.     [Download]
>gi|162453270|ref|YP_001615637.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MALQAHLQLKGITQGPIDGSVTQKGREKTIAVIAVQHQVVSPRDPATGLPSGKRQHKPFVITKELDKATP
LLYNALVNNESISEWTLKFYTPGTAASKNVGKEQNHYTVKLTNATVASIDFHMDNTRGGDGAKDRPEYER
VSFTYQKIEWSFDDGDGARQADDDWETPQG
 
Nucleotide Sequence: 513 bp     [Download]
>gi|162448269|ref|NC_010162.1|:7017795-7018307 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGCGTTGCAAGCTCATCTCCAGTTGAAGGGCATCACCCAGGGCCCCATCGATGGCTCGGTCACCCAGA
AGGGTCGCGAGAAGACCATCGCTGTCATCGCCGTCCAGCATCAGGTCGTGAGCCCGCGTGATCCGGCGAC
CGGGCTGCCCAGCGGGAAGCGCCAGCACAAGCCCTTCGTGATCACGAAGGAGCTCGACAAGGCAACCCCC
CTTCTTTACAACGCCCTGGTCAACAACGAGAGCATCTCGGAGTGGACGCTCAAGTTCTACACGCCGGGCA
CCGCGGCGTCGAAGAACGTCGGCAAGGAGCAGAACCACTACACGGTCAAGCTCACGAACGCGACGGTCGC
GAGCATCGACTTCCACATGGACAACACGCGCGGCGGGGACGGCGCGAAGGATCGGCCGGAGTACGAGCGG
GTCTCCTTCACGTACCAGAAGATCGAGTGGTCGTTCGATGACGGCGACGGCGCGCGTCAGGCGGACGATG
ACTGGGAGACGCCGCAGGGCTAG
 Primer design

Protein ID: 162453271
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4995
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7018446..7018931 [+]
Producthypothetical protein
NoteTssD
UniProt IDA9FKX5
KEGG IDscl:sce4995
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-27, Aligned region: 6..146
Protein Sequence: 161 a.a.     [Download]
>gi|162453271|ref|YP_001615638.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MPLSAYLRLVGERQGEIRGSVTQKGREGSILVTEVFHSLVGPRDPVTGRPTGKRMHKPFIVTKDLDRSTP
LLLSILSHNESIPRWELQFYRSIAIGVERPVFTVQLTNANISSIQFHMLNVRNPGQSRLPEQEEVAFTYQ
KVVWTWNDGGLSAEDDWLTPR
 
Nucleotide Sequence: 486 bp     [Download]
>gi|162448269|ref|NC_010162.1|:7018446-7018931 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGCCCCTCAGCGCCTACCTCAGACTCGTCGGCGAAAGACAAGGGGAAATCAGGGGCTCCGTCACCCAGA
AGGGGCGAGAAGGTAGCATCCTCGTCACCGAGGTGTTCCACTCGCTGGTGGGGCCGCGCGACCCGGTCAC
CGGGCGCCCGACGGGCAAGCGGATGCACAAGCCCTTCATCGTCACGAAGGACCTCGATCGGTCCACGCCG
CTCCTCCTCAGCATCCTCAGCCACAACGAGAGCATCCCCCGCTGGGAGCTCCAGTTCTACAGGTCGATCG
CGATCGGCGTCGAGAGGCCTGTCTTCACGGTCCAGCTCACGAACGCGAACATCTCGAGCATCCAGTTCCA
CATGCTCAACGTGAGGAACCCGGGGCAATCGCGCCTGCCCGAGCAGGAGGAGGTCGCGTTCACGTACCAG
AAGGTCGTCTGGACCTGGAACGACGGGGGCCTCTCCGCGGAAGACGACTGGCTCACCCCGCGCTGA
 Primer design