SecReT6
Protein ID: 162453272
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4996
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7018978..7019397 [+]
Producthypothetical protein
NoteTssE
UniProt IDA9FKX9
KEGG IDscl:sce4996
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.00E-16, Aligned region: 27..116
Protein Sequence: 139 a.a.     [Download]
>gi|162453272|ref|YP_001615639.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MAGASLLTRIAHAADPHSTERHTYRDHDLESAILTHLGHMLNTRQGSSLTCPDYGLMEVSEVLHEFPEAI
GLVQRSLKNCIQTYEPRLKNVQVRHLRTDTVQSMVLEFEITAQIHFPDGRRQALRLGAAVDQSGNVRMT
 
Nucleotide Sequence: 420 bp     [Download]
>gi|162448269|ref|NC_010162.1|:7018978-7019397 Sorangium cellulosum 'So ce 56' chromosome, complete genome
GTGGCCGGCGCCTCCCTCCTCACCCGAATCGCGCACGCGGCCGACCCGCACTCGACGGAGCGGCACACCT
ACCGGGATCACGACCTCGAGTCGGCCATCCTGACGCACCTCGGGCACATGCTGAACACCCGCCAGGGGAG
CTCGCTGACCTGCCCGGACTACGGCCTCATGGAGGTCTCGGAGGTCCTGCATGAGTTCCCCGAGGCGATC
GGCCTGGTGCAGCGCTCGCTCAAGAACTGCATCCAGACCTACGAGCCGCGGCTGAAGAACGTGCAGGTCC
GGCACCTGCGCACCGACACGGTCCAGTCGATGGTCCTCGAGTTCGAGATCACCGCGCAGATCCACTTTCC
CGATGGCCGGCGGCAGGCGCTCCGGCTCGGCGCTGCAGTGGACCAGAGCGGCAACGTCCGGATGACGTAG
 Primer design