SecReT6
Protein ID: 162453273
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4997
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7019471..7021240 [+]
Producthypothetical protein
NoteTssF
UniProt IDA9FKY1
KEGG IDscl:sce4997
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.90E-179, Aligned region: 2..588
Protein Sequence: 589 a.a.     [Download]
>gi|162453273|ref|YP_001615640.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MFNKYYQDELTYLRDLGREFAAAYPGIAPMLAEKGGDPDVERLLEGVAFLTGKIRQKLDDELPEVIHSVA
SLLFPHYLRQIPATSIIEFTPLPNVVREKLVVARHAEVGSVPVDGVSCRFRTTQDVELVPLAVEDVRVDT
GAQLAQTLRIELRLTGGAALSGLSLSSLRFYIHGERRLQDDLRLWVGAHVDTVALAAVDAAGRDTTIASL
PARAVRLTGFSDEESLIPYPKTVYPGFRLLQEFFTLPQKFAFFEVTGLQALSAERISDRFAILLQFKDGL
PPGTRIGKENIRLFCSPVVNLFEHTSDPIKPEATKHEYLCRPAGAAPAAFEIHSIDKVVGIARRTSQRVE
IPSFFSFQHELDPEAAARTIFYQAHLRPAAIGDGIDMYLSFGSPQDAGALPEFDVISIEATSTNRRLPAQ
LKLGDLRVPTATSPAVASFTNLTGVTAPLPPPLGRELQWRVLAHMAMSYRSITELEVLRATVDLYNFQAI
VDRQAARANQLRLAAIKAIRVRPTDRLYRGAPVRGVAVDIELDEGGFVGEGEMYLFASILNEMLGSYVSL
NSFTQLTVTGTNTRVVHKWDPKSGSLTLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|162448269|ref|NC_010162.1|:7019471-7021240 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGTTCAACAAGTACTACCAGGACGAGCTCACCTACCTGAGGGATCTGGGGCGCGAGTTCGCCGCCGCCT
ACCCCGGGATCGCCCCCATGCTCGCGGAGAAAGGCGGGGACCCCGACGTCGAGCGCCTGCTCGAGGGCGT
CGCGTTCCTGACCGGCAAGATCCGCCAGAAGCTCGACGACGAGCTCCCCGAGGTGATCCACTCGGTCGCG
TCGCTGCTCTTTCCGCACTACCTCCGCCAGATCCCGGCGACCTCGATCATCGAGTTCACGCCGCTCCCGA
ACGTCGTGCGCGAGAAGCTCGTCGTCGCTCGGCACGCGGAGGTCGGGTCGGTGCCGGTCGACGGCGTCTC
GTGCCGGTTCCGCACGACCCAGGACGTCGAGCTCGTCCCGCTCGCGGTGGAGGACGTGCGCGTCGACACG
GGCGCGCAGCTCGCGCAGACGCTCCGCATCGAGCTCCGCCTGACCGGCGGCGCCGCGCTGTCGGGCCTGT
CGCTCTCCTCGCTGCGCTTCTACATCCACGGCGAGCGCAGGCTGCAGGACGACCTCCGCCTCTGGGTCGG
GGCGCACGTCGACACCGTCGCGCTCGCCGCGGTGGACGCCGCGGGGCGCGACACGACGATCGCGTCGCTC
CCGGCGCGCGCCGTGCGGCTCACCGGCTTCTCCGATGAAGAGTCGCTGATCCCGTACCCGAAGACGGTCT
ATCCGGGCTTCCGGCTCCTGCAGGAGTTCTTCACGCTCCCGCAGAAGTTCGCGTTCTTCGAGGTGACCGG
CCTCCAGGCGCTCTCGGCGGAGCGGATCTCCGACCGGTTCGCGATCCTGCTGCAGTTCAAGGACGGGCTC
CCGCCGGGGACGCGGATCGGCAAGGAGAACATCCGCCTGTTCTGCTCGCCGGTCGTGAACCTGTTCGAGC
ACACGAGCGATCCGATCAAGCCCGAGGCCACGAAGCACGAGTACCTCTGCCGCCCGGCGGGCGCGGCGCC
CGCGGCCTTCGAGATCCACAGCATCGACAAGGTCGTCGGCATCGCCCGGCGCACGAGCCAGCGCGTCGAG
ATCCCCTCGTTCTTCAGCTTCCAGCACGAGCTCGATCCCGAGGCCGCCGCGCGGACGATCTTCTACCAGG
CGCACCTCCGCCCGGCCGCCATCGGCGACGGCATCGACATGTACCTCTCGTTCGGCTCCCCGCAGGACGC
GGGGGCCCTCCCCGAGTTCGACGTGATCAGCATCGAGGCGACGAGCACGAACCGCCGCCTGCCGGCGCAG
CTCAAGCTCGGCGATCTCAGGGTGCCGACGGCGACCTCACCCGCCGTGGCGAGCTTCACCAACCTCACCG
GCGTCACCGCGCCGCTCCCGCCGCCGCTCGGGCGCGAGCTGCAGTGGCGCGTCTTGGCCCACATGGCGAT
GAGCTACCGCTCGATCACCGAGCTCGAGGTGCTCCGGGCGACGGTCGATCTCTACAATTTCCAGGCGATC
GTCGATCGTCAGGCGGCGCGCGCGAACCAGCTCCGCCTGGCCGCGATCAAGGCGATCCGGGTGCGGCCGA
CGGATCGGCTGTACCGAGGGGCGCCGGTGCGCGGCGTCGCGGTCGACATCGAGCTCGACGAGGGCGGGTT
CGTCGGCGAGGGCGAGATGTACCTGTTCGCGAGCATCCTGAACGAGATGCTCGGGTCCTACGTCTCGCTG
AACTCGTTCACGCAGCTGACGGTCACCGGCACGAATACACGCGTGGTGCACAAATGGGACCCGAAGAGCG
GCAGCCTGACGCTGATCTGA
 Primer design