SecReT6
Protein ID: 162453274
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce4998
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7021204..7022337 [+]
Producthypothetical protein
NoteTssG
UniProt IDA9FKY5
KEGG IDscl:sce4998
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.20E-77, Aligned region: 37..342
Protein Sequence: 377 a.a.     [Download]
>gi|162453274|ref|YP_001615641.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MGPEERQPDADLRPAAPRGAASADPVALETLRRFADTAPRFSYYRLIYLLERLFPAAPPVGQLGPVQDER
IRLRGDPSLIFASSDVSELAPVKAADGVERARVSTTFLALYGSVSPLPAYFIEQIAQADYQGGPQPIREL
LDVFHHRLLSLLYRAWTKYRLPVTYRKQGADPFSRRMLCAVGIDGFRGYDTPLDRFFFLRYASVLASKSR
SARNLETVLSEMLGNIGVKIEQFVGHWTKIEKPFRNKLGVMNHQLGESLTLGRYVFDGSGRYKVVLGPVG
YDEYLSFLPGGRRQDLVRGVIETFTPGIHDVMLEIHVDTEEAPRFQLGSPRAATLKRTAWIGGSAAERLV
ITIPLDDKHLAGGDDEDDDDRGEPPPM
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|162448269|ref|NC_010162.1|:7021204-7022337 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGGACCCGAAGAGCGGCAGCCTGACGCTGATCTGAGGCCGGCCGCGCCGAGAGGCGCCGCGAGCGCCG
ACCCCGTCGCGCTGGAGACGCTCCGGCGCTTCGCGGATACCGCGCCACGCTTCTCGTACTACCGCCTCAT
CTACCTGCTCGAGCGGCTCTTCCCTGCCGCGCCGCCGGTGGGCCAGCTCGGGCCGGTGCAGGACGAGCGC
ATCCGGCTGCGCGGCGACCCCTCGCTCATCTTCGCCTCGAGCGACGTGAGCGAGCTCGCGCCGGTCAAGG
CCGCTGACGGCGTGGAGCGCGCCCGCGTCTCGACCACGTTCCTCGCCCTGTACGGCTCGGTGTCGCCGCT
GCCAGCGTACTTCATCGAGCAGATCGCGCAGGCCGACTACCAGGGCGGCCCGCAGCCGATCCGCGAGCTC
CTCGACGTCTTCCACCACCGGCTCCTGTCGCTGCTCTACCGCGCGTGGACGAAGTACCGCCTGCCCGTCA
CGTACCGCAAGCAGGGCGCCGATCCCTTCTCGCGCCGCATGCTCTGCGCGGTCGGCATCGACGGCTTCCG
CGGCTACGACACGCCGCTCGATCGCTTCTTCTTCCTCCGCTACGCGTCGGTCCTCGCCTCGAAGTCGCGC
TCGGCGAGGAACCTGGAGACGGTGCTGTCCGAGATGCTCGGCAACATCGGCGTGAAGATCGAGCAGTTCG
TCGGTCACTGGACGAAGATCGAGAAGCCGTTCAGGAACAAGCTCGGCGTGATGAACCATCAGCTGGGCGA
GAGCCTGACCCTGGGGCGCTACGTGTTCGACGGCTCCGGCCGCTACAAGGTCGTGCTCGGCCCGGTGGGC
TACGACGAGTACCTCTCCTTCTTGCCCGGGGGTCGGCGGCAGGATCTGGTCCGCGGCGTCATCGAGACGT
TCACGCCGGGCATCCACGACGTGATGCTCGAGATCCACGTGGACACGGAGGAGGCGCCGCGGTTCCAGCT
CGGCTCGCCGCGCGCCGCGACGCTCAAGCGCACCGCGTGGATCGGCGGATCTGCGGCGGAGCGGCTCGTG
ATCACGATCCCCCTCGACGACAAGCACCTCGCGGGCGGCGACGACGAGGACGACGACGATCGGGGCGAGC
CCCCGCCGATGTGA
 Primer design