SecReT6
Protein ID: 162453278
SecReT6 ID248
T6SS typei1
Gene symbol-
Locus tagsce5002
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]7025152..7026306 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDA9FKZ8
KEGG IDscl:sce5002
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.60E-16, Aligned region: 304..373
Protein Sequence: 384 a.a.     [Download]
>gi|162453278|ref|YP_001615645.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MRPCPNCAWMLKETDAACSMCGTSVAGAAPGASVPVAPPPVQAGAGAYAPPGPPGYPGQPAVSGYGGAAS
PGYAAGGAQGAYPPPPQAYGVGGGGLSVPASPGGSVAFSTGGEAPFPVSPWARAAPSAGLTSQPASPPMN
APGVPPVQPALGAPGPGMVPGASMGGAMGQQPVAPAPVFGAPPQMVAPPPMVVPAGASGLVAPPMVQPGV
VAPPPMVQPGVVAPPPMVQGGALAPPQMVQGGVPAVAQARAPAIVAPPIVQGAVSGAVPQVSAQPARVLV
GFIVTFQNDPGGSFWPIYSGRTQVGRAGADAATEIGLADASASSRHASIHADPTTGQVFIEDDGSRNGTF
VNEQRLGQGERRQLRDNDRLRLGSTTFVVKVLVA
 
Nucleotide Sequence: 1155 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c7026306-7025152 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGAGGCCGTGTCCGAACTGCGCGTGGATGCTCAAGGAGACCGACGCTGCCTGCTCGATGTGCGGTACGA
GCGTGGCGGGCGCAGCGCCTGGAGCGTCCGTTCCGGTCGCGCCTCCGCCGGTGCAGGCGGGGGCTGGCGC
TTATGCTCCGCCTGGCCCGCCGGGCTATCCAGGGCAGCCAGCCGTCTCGGGTTATGGCGGTGCGGCGTCG
CCAGGCTACGCGGCGGGGGGCGCGCAGGGCGCCTATCCGCCTCCTCCTCAGGCCTACGGGGTCGGGGGAG
GCGGGCTCTCGGTGCCCGCATCGCCGGGGGGAAGCGTCGCCTTCTCGACGGGCGGGGAAGCTCCCTTCCC
GGTCTCCCCCTGGGCCCGAGCGGCACCTTCCGCGGGGCTCACGTCGCAGCCGGCGTCTCCTCCGATGAAC
GCGCCGGGCGTCCCGCCGGTCCAGCCGGCGCTCGGGGCGCCGGGGCCGGGCATGGTGCCTGGCGCGTCAA
TGGGTGGCGCGATGGGGCAGCAGCCCGTGGCGCCGGCGCCGGTCTTCGGCGCGCCTCCGCAGATGGTGGC
GCCCCCGCCGATGGTCGTGCCGGCGGGGGCGTCTGGGCTGGTCGCGCCGCCGATGGTGCAGCCGGGCGTG
GTGGCGCCGCCGCCGATGGTGCAGCCGGGCGTGGTGGCGCCGCCGCCGATGGTGCAGGGGGGCGCGCTCG
CGCCGCCGCAGATGGTGCAGGGCGGGGTGCCGGCGGTCGCTCAGGCCAGGGCGCCTGCGATCGTCGCGCC
GCCGATCGTCCAGGGCGCGGTCTCGGGTGCGGTGCCGCAGGTGTCGGCGCAGCCCGCGCGTGTCCTCGTC
GGCTTCATCGTGACGTTCCAGAACGATCCCGGAGGCAGCTTCTGGCCGATCTACAGCGGCCGGACGCAGG
TGGGCCGCGCCGGGGCGGACGCCGCGACGGAGATCGGGCTCGCGGACGCGAGCGCCTCCTCACGGCACGC
GTCGATCCACGCGGATCCGACGACGGGTCAGGTCTTCATCGAGGACGACGGCTCGCGCAACGGCACCTTC
GTCAACGAGCAGCGCCTCGGACAGGGCGAGCGCCGGCAGCTGCGCGACAACGACCGGCTGCGCCTCGGGA
GCACGACGTTCGTGGTGAAGGTGCTGGTCGCCTGA
 Primer design