SecReT6
Protein ID: 162457615
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9329
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12976178..12978136 [+]
Producthypothetical protein
NoteTssI
UniProt IDA9GHI6
KEGG IDscl:sce9329
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-79, Aligned region: 29..332
Phage_base_V [PF04717], Evalue: 5.30E-26, Aligned region: 76..105
Phage_base_V [PF04717], Evalue: 5.30E-26, Aligned region: 360..453
Gp5_C [PF06715], Evalue: 3.50E-12, Aligned region: 495..517
Gp5_C [PF06715], Evalue: 3.50E-12, Aligned region: 519..541
Gp5_C [PF06715], Evalue: 3.50E-12, Aligned region: 541..559
Gp5_C [PF06715], Evalue: 3.50E-12, Aligned region: 561..577
Gp5_C [PF06715], Evalue: 3.50E-12, Aligned region: 579..595
Protein Sequence: 652 a.a.     [Download]
>gi|162457615|ref|YP_001619982.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MPYSQAKTILALHSPLGPDALALVRIHGEERLSGLFRFELDLLSEERAIDFASIVGQGITAVIRLSSGGE
RTIHGVVTRFRQAGRVHVDGGQPRTAYRAEIHPWLWFLTRTTDSRIFQDRSVPDIVKQIFDDLGFSDYKD
ELTGSYAPREVCVQYQETAFQFISRLLEEEGIYYYFQHEDGKHTLVLGDDSAGNPRCPDLGDVRYVGAAD
TSTRDEDAMTVCELIGEVVAGSYAATDYNFKAPSTSLLSQASGGGAKLALFEYPGGYADKSAGDAIATRR
IEAEEGVARRLVGSSFCRAFTAGHAFQLVQHERSDVNGEYLLLAVTHSADNDEYQNSFEAMPMQSPFRPA
RVTPRPIIAGAQTAVVVGKSGEEIWTDEFGRIKVQFHWDRYGKRDENSSCWIRVAQSWAGKGWGSWYLPR
VGQEVVVSFLGGDPDRPLCTGSVYNADQTVPYALPGEQTKSTLLSRSSKGGSAGNELRFEDKKDSEELFM
HAQKDMVVDVENDWTIGVKHDQSITIDNDQTLAVGGDQTISVEKSRTVTIDKGDDLLTVGKGNRTIDVSK
GNESHAVKGTRDLTVEGHETHTNKANFTQEVKGNHVLKVKGNLVIEAKTVTIKSEQAMTLKAGKALKGEA
GADLTLKGDGKVAIKGSEVKNN
 
Nucleotide Sequence: 1959 bp     [Download]
>gi|162448269|ref|NC_010162.1|:12976178-12978136 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGCCCTACTCCCAGGCGAAGACGATCCTCGCCCTCCATAGCCCCCTCGGCCCCGACGCCCTCGCCCTCG
TCAGGATCCATGGCGAGGAGCGGCTGTCTGGCCTGTTCCGGTTCGAGCTCGACCTCCTGTCCGAGGAGCG
GGCCATCGATTTTGCTTCCATCGTCGGCCAGGGCATCACCGCGGTCATTCGCCTCTCCAGCGGCGGCGAG
CGCACGATCCACGGCGTCGTCACGCGCTTCCGTCAGGCCGGGCGTGTCCACGTGGACGGCGGCCAGCCGA
GGACCGCCTATCGCGCCGAGATCCACCCCTGGCTCTGGTTTCTGACCAGGACCACCGACTCCCGCATCTT
CCAGGACAGATCGGTGCCCGATATCGTGAAGCAGATCTTCGATGATCTCGGCTTCTCCGATTACAAGGAC
GAGCTGACCGGCTCGTACGCTCCTCGCGAGGTGTGTGTCCAGTACCAGGAGACCGCGTTTCAGTTCATCT
CGCGGCTGCTGGAGGAGGAGGGCATCTATTACTATTTCCAGCACGAGGACGGAAAGCACACCCTCGTCCT
CGGCGACGACAGCGCGGGCAACCCGCGCTGCCCCGATCTCGGCGACGTGCGTTACGTGGGCGCCGCCGAT
ACCTCGACGCGCGATGAGGACGCGATGACCGTCTGCGAGCTCATCGGAGAGGTCGTCGCGGGGTCGTATG
CGGCGACCGATTACAACTTCAAGGCGCCCAGCACCTCGCTGCTCAGCCAGGCGAGCGGCGGCGGGGCGAA
GCTCGCGCTCTTCGAGTATCCCGGCGGCTACGCCGACAAGAGCGCCGGCGACGCGATCGCCACGCGTCGC
ATCGAGGCGGAGGAGGGCGTGGCCCGGCGCCTCGTCGGCAGCTCGTTCTGCCGCGCGTTCACGGCCGGCC
ATGCGTTCCAGCTCGTCCAGCACGAGCGCTCCGACGTGAACGGCGAGTACCTGCTGCTCGCCGTCACGCA
CTCGGCCGACAACGACGAGTACCAGAACTCCTTCGAGGCGATGCCCATGCAGAGCCCCTTTCGCCCCGCG
CGCGTGACGCCGAGGCCCATCATCGCGGGGGCTCAGACGGCCGTCGTCGTCGGCAAGAGCGGCGAGGAGA
TATGGACCGACGAGTTCGGCCGCATCAAGGTGCAGTTTCACTGGGACCGGTACGGCAAGCGCGACGAGAA
CAGCTCCTGCTGGATCCGCGTCGCCCAGTCCTGGGCCGGCAAGGGGTGGGGGAGCTGGTACTTGCCGCGC
GTCGGCCAGGAGGTCGTGGTCAGCTTCCTCGGCGGCGATCCCGACCGGCCGCTCTGCACCGGGTCGGTGT
ACAACGCGGACCAGACGGTCCCCTACGCGCTTCCCGGCGAGCAGACGAAGAGCACGCTCCTGTCCCGGTC
GTCGAAGGGGGGCAGCGCGGGCAACGAGCTCCGCTTCGAGGACAAGAAGGACAGCGAGGAGCTCTTCATG
CACGCCCAGAAGGACATGGTCGTCGACGTGGAGAACGACTGGACGATCGGCGTCAAGCACGACCAGTCGA
TCACCATCGATAACGATCAGACGCTGGCGGTGGGCGGAGACCAGACCATCAGCGTGGAGAAGAGCCGCAC
GGTGACGATCGACAAGGGGGACGACCTGCTGACGGTGGGGAAGGGCAACCGCACGATCGACGTGTCGAAG
GGCAACGAGTCGCACGCGGTCAAGGGGACGCGGGACCTGACGGTCGAGGGGCACGAGACCCACACCAACA
AGGCCAACTTCACCCAGGAGGTGAAGGGCAATCACGTCCTCAAGGTGAAGGGGAACCTGGTCATCGAGGC
CAAGACGGTGACCATCAAGAGCGAGCAGGCGATGACGCTCAAGGCTGGGAAGGCGCTGAAGGGCGAGGCC
GGCGCGGATCTCACGTTGAAGGGCGACGGGAAGGTCGCGATCAAGGGCAGCGAGGTGAAGAACAACTGA
 Primer design