SecReT6
Protein ID: 162457623
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9337
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12985137..12986219 [-]
Producthypothetical protein
NoteTssG
UniProt IDA9GHK5
KEGG IDscl:sce9337
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-86, Aligned region: 21..325
Protein Sequence: 360 a.a.     [Download]
>gi|162457623|ref|YP_001619990.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MATDGRREGAPLDEEDVLFAEGRRFDFFQAVALLEARAEGCRSVGESAEPAAEAVRLRGAIDLAFPETDV
AGIERPAREGEPAVLTASFMSLAGALGPLPPPFAELVYQRAARRDFALRDFLDIFNHRLLSLVYRIRKRH
RIGLGVASPEQDDAARYLYALIGLGLPSLRGRLSVSDRALLEPAALVAREVRPMAGLTALLRHHLRVPIE
AAPLTGAYHPIEESDRTAIGPSGRNRGLGHGAILGRRAWDQEAGFELVVGPLSLRDYLRCLPGGDLLEPL
CALTRFYAGEVLSFTVLLRLRAEEAPAARLGRRHGARLGTTACLGGGARRREPIEKRLRGAALGGAGDPD
AGPGASPRSG
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12986219-12985137 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGCAACCGATGGCAGGCGCGAAGGCGCTCCTCTAGACGAGGAGGACGTGCTCTTCGCCGAGGGCCGGC
GCTTCGACTTCTTCCAGGCCGTGGCGCTGCTCGAGGCGCGGGCGGAGGGCTGCCGGAGCGTGGGCGAGAG
CGCCGAGCCCGCGGCCGAGGCGGTGCGGCTGCGCGGCGCGATCGACCTCGCGTTCCCCGAGACGGACGTG
GCCGGGATCGAGCGCCCCGCGCGCGAGGGGGAGCCGGCGGTGTTGACCGCGAGCTTCATGAGCCTCGCGG
GCGCGCTCGGGCCGCTGCCGCCGCCGTTCGCGGAGCTCGTGTACCAGCGCGCGGCGCGGCGCGACTTCGC
GCTGCGCGATTTCCTGGACATCTTCAATCATCGCCTGCTCTCGCTGGTCTACCGCATCCGCAAGCGGCAC
CGGATCGGGCTCGGCGTGGCGTCTCCGGAGCAGGACGACGCCGCGCGGTACCTCTATGCGTTGATCGGCC
TCGGGTTGCCGTCGCTGCGCGGGCGGCTCTCGGTGAGCGATCGCGCGCTGCTCGAGCCGGCGGCGCTGGT
GGCGCGGGAGGTGCGGCCGATGGCGGGCCTCACGGCGCTGCTGCGGCATCACCTGCGGGTGCCGATCGAG
GCGGCGCCGCTGACCGGGGCGTACCACCCGATCGAGGAGAGCGATCGGACGGCGATCGGCCCCTCGGGGC
GCAACCGGGGGCTCGGGCATGGGGCGATCCTGGGGCGGCGGGCGTGGGACCAGGAGGCGGGGTTCGAGCT
CGTCGTGGGGCCGCTGTCGCTCCGGGATTACCTGCGCTGCTTGCCTGGAGGGGACCTGCTCGAGCCGCTG
TGCGCGCTGACGCGGTTCTATGCGGGCGAGGTGCTGAGCTTCACGGTGCTCCTGCGCCTGCGCGCCGAGG
AGGCGCCGGCGGCGCGGCTCGGGAGGCGGCACGGGGCGCGCCTCGGGACGACGGCGTGCCTCGGCGGGGG
CGCGCGGAGGCGAGAGCCGATCGAGAAGAGGCTGCGGGGGGCGGCGCTCGGGGGTGCTGGCGATCCGGAT
GCGGGCCCGGGCGCCTCGCCGCGGTCTGGTTGA
 Primer design