SecReT6
Protein ID: 162457624
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9338
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12986183..12987985 [-]
Producthypothetical protein
NoteTssF
UniProt IDA9GHK7
KEGG IDscl:sce9338
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.60E-199, Aligned region: 10..600
Protein Sequence: 600 a.a.     [Download]
>gi|162457624|ref|YP_001619991.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MTTTDHDAELLDLYARELAYLRERGAEFAAAYPKIAARLGLEGRHSADPHVERLLESFAFLTARLQRRLD
SDLPELTTSLLGVLYPPLLSPIPSMAIAAFEVSPRDSKLTSGHVIDRGTPLFAEAHGGPTCRFRTCAPVT
LWPIEIEAAGFGAPEALDLPPGSGGVMAALRIRLRSGGPPLRALGVRRLRFFLSGGGLNGYRLYELLFGH
TLRVLCAGEDGSRELAEARLHPVGFGPDEEALPYPVHASPGHRLVQEYFAFPEKFLFFDVELTQLPEGTA
CSLLFLLDQRPPASLVVRADTFRLGCAPIVNLFSRTTEPIRVDHRFPEYRLVADARRERTTEIHSIHKVT
ATAPGEAEQVEYAPFFSFTHHAEGAGPRAFWQARRVATSREDVPGTDVTLSFVDLDLSPRRPPSRVVYAS
VLCTNRDLPEELSAGVSLSLERGAAMGRITCLTKPTPQRDPPLGGQALWRLVSNLSQNHLSISGPGGMDA
LKEILRVYLFASIPEAERQIQGIVGVSARTVTRRIGADAWRGFCRGTEVTLTLDEEQFVGSSPLLFAEVL
SRYLSLHAHINSFTELVLRSTGRAEVWKRWQPMAGAKALL
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12987985-12986183 Sorangium cellulosum 'So ce 56' chromosome, complete genome
GTGACGACGACCGACCACGACGCCGAGCTGCTCGATCTCTACGCCCGCGAGCTCGCCTACCTGCGGGAGC
GCGGCGCCGAGTTCGCCGCGGCGTATCCCAAGATCGCCGCGCGCCTCGGCCTGGAGGGGCGCCACTCGGC
GGATCCGCACGTCGAGCGCCTGCTCGAGTCGTTCGCGTTCCTGACGGCGCGCCTCCAGCGCCGCCTCGAC
AGCGATCTCCCCGAGCTCACCACGTCGCTGCTCGGCGTCCTCTATCCGCCGCTGCTCTCGCCCATCCCGT
CGATGGCGATCGCGGCCTTCGAGGTGAGCCCCAGGGACAGCAAGCTCACCTCGGGCCACGTGATCGACCG
GGGCACGCCGCTCTTCGCCGAGGCGCACGGGGGCCCCACCTGCCGTTTCCGGACGTGCGCTCCGGTCACC
CTCTGGCCGATCGAGATCGAGGCCGCCGGCTTCGGCGCGCCCGAGGCGCTGGATTTGCCGCCGGGCTCCG
GCGGCGTGATGGCGGCGCTCCGCATCCGCCTGCGGAGCGGCGGCCCTCCGCTGCGCGCGCTCGGGGTGCG
GCGGCTGCGCTTCTTCCTGAGCGGCGGTGGCCTGAACGGCTATCGCCTGTACGAGCTGCTCTTCGGCCAC
ACGCTGCGCGTCCTCTGCGCCGGCGAGGACGGCAGCCGGGAGCTCGCGGAGGCGCGGCTCCACCCGGTCG
GCTTCGGGCCCGACGAGGAGGCGCTCCCCTACCCCGTGCACGCGTCCCCCGGGCACCGGCTGGTCCAGGA
GTACTTCGCCTTTCCCGAGAAGTTTCTCTTCTTCGACGTCGAGCTGACGCAGCTCCCCGAGGGCACCGCG
TGCAGCCTGCTGTTCCTGCTCGATCAGCGCCCGCCCGCGAGCCTCGTGGTGCGGGCCGACACCTTCCGGC
TCGGCTGCGCGCCGATCGTCAACCTGTTCTCCCGCACGACAGAGCCGATCCGGGTCGATCACCGCTTCCC
GGAGTATCGCCTGGTCGCGGACGCGCGCCGCGAGCGCACGACCGAGATCCACTCGATCCACAAGGTCACG
GCAACGGCACCGGGCGAGGCGGAGCAGGTGGAGTACGCGCCGTTCTTCTCCTTCACGCACCACGCCGAGG
GCGCGGGCCCGCGCGCGTTCTGGCAGGCCCGCCGCGTCGCGACGTCGCGCGAGGACGTGCCCGGCACGGA
CGTGACCCTGTCGTTCGTCGATCTCGACCTCTCGCCTCGGAGGCCCCCATCCCGGGTCGTGTACGCCTCG
GTGCTGTGCACCAACCGCGACCTCCCCGAGGAGCTGTCTGCCGGCGTGTCGCTGTCCCTCGAGCGTGGGG
CCGCCATGGGCCGGATCACCTGCCTCACCAAGCCGACCCCGCAGCGCGATCCTCCGCTCGGCGGACAGGC
GCTCTGGCGGCTCGTCTCGAACCTATCGCAGAATCACCTCTCGATCTCGGGGCCGGGCGGCATGGACGCG
CTGAAGGAGATCCTGCGCGTCTATCTCTTCGCGTCGATCCCCGAGGCGGAGCGCCAGATCCAGGGCATCG
TCGGCGTGTCGGCGCGCACCGTGACGCGGCGGATCGGCGCGGACGCGTGGCGCGGGTTCTGCCGCGGGAC
GGAGGTGACGCTGACGCTCGACGAGGAGCAGTTCGTCGGATCGAGCCCGCTCTTGTTCGCGGAGGTGCTG
AGTCGTTATCTCTCGCTGCACGCGCACATCAACTCGTTCACGGAGCTCGTGCTGAGGAGCACGGGGCGCG
CGGAGGTCTGGAAGCGATGGCAACCGATGGCAGGCGCGAAGGCGCTCCTCTAG
 Primer design