SecReT6
Protein ID: 162457625
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9339
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12987982..12988443 [-]
Producthypothetical protein
NoteTssE
UniProt IDA9GHL0
KEGG IDscl:sce9339
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.60E-15, Aligned region: 38..142
Protein Sequence: 153 a.a.     [Download]
>gi|162457625|ref|YP_001619992.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MEESWGAADAGRVPLFDRLVDDTPSQRSEARPKRSHDLDALRASVLRELERLLGTRCPVPGDVALARQRT
VIDYGLPDLELGGREVVKEDRFRVARLIQQTIEAYEPRLARVEVELLPPADGDARHRVAVRAQLVTERVR
EPLSFTLPLPEVG
 
Nucleotide Sequence: 462 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12988443-12987982 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGAAGAGAGCTGGGGAGCAGCGGACGCGGGGCGCGTGCCCCTCTTCGACCGCCTGGTCGACGACACCC
CGTCGCAGCGCAGCGAGGCGCGGCCGAAGCGCAGCCACGACCTCGACGCGCTGCGCGCCTCGGTTCTCCG
CGAGCTCGAGCGGCTGCTCGGCACGCGCTGCCCCGTGCCCGGAGACGTGGCCCTCGCACGCCAGCGCACG
GTGATCGACTACGGCCTGCCCGACCTCGAGCTCGGCGGCCGCGAGGTCGTCAAGGAAGACCGGTTCCGCG
TCGCGCGGCTCATCCAGCAGACGATCGAGGCGTACGAGCCCCGCCTCGCGCGGGTCGAGGTCGAGCTGCT
CCCTCCGGCGGACGGCGACGCGCGGCACCGCGTCGCCGTCCGCGCGCAGCTCGTCACCGAGCGGGTCCGC
GAGCCGCTCAGCTTCACCCTGCCGCTGCCGGAGGTCGGGTGA
 Primer design