SecReT6
Protein ID: 162457626
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9340
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12988498..12988986 [-]
Producthypothetical protein
NoteTssD
UniProt IDA9GHL2
KEGG IDscl:sce9340
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-37, Aligned region: 6..135
Protein Sequence: 162 a.a.     [Download]
>gi|162457626|ref|YP_001619993.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MQNIFWEIDGIKGESTSAQGKDMIELLSFSHGVAMPLTAGPSNTSRASGRCVHNDFTITKYLDIASPTLN
LKCCGGEDIKSMKVHIWKADVAGAPHKYMTYTFDSCIITSVSVTGGGDQPIETITFGYKKVTWDYAQQKQ
EAPGGAKGKSSASFSVEENKGK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12988986-12988498 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGCAGAATATCTTCTGGGAAATCGATGGCATCAAGGGAGAGAGCACGTCGGCTCAGGGCAAGGACATGA
TCGAGCTCCTGTCCTTCAGCCACGGAGTGGCCATGCCGCTCACGGCCGGGCCCTCGAACACGAGCCGCGC
GAGCGGCCGCTGCGTGCACAACGATTTCACGATCACCAAGTACCTCGACATCGCGTCGCCGACGCTCAAC
CTCAAGTGCTGCGGCGGCGAGGACATCAAGTCCATGAAGGTGCACATCTGGAAGGCTGACGTCGCTGGGG
CGCCGCACAAGTACATGACGTACACCTTCGATAGCTGCATCATCACCTCCGTCTCGGTGACGGGCGGCGG
GGATCAGCCGATCGAGACCATCACCTTCGGCTACAAGAAGGTCACCTGGGACTACGCGCAGCAGAAGCAG
GAGGCGCCGGGCGGGGCCAAGGGCAAGAGCTCGGCGAGCTTCAGCGTCGAAGAGAACAAGGGCAAGTGA
 Primer design