SecReT6
Protein ID: 162457627
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9341
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12989108..12990595 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9GHL5
KEGG IDscl:sce9341
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-186, Aligned region: 69..491
Protein Sequence: 495 a.a.     [Download]
>gi|162457627|ref|YP_001619994.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MAEESTQAVGSAAAAPAEEMSLIDQILAQGMVRGAAEPQRKHARDLIDEFVNQVLDEKVKVGSDTVAAIE
ARIAEIDARISAQLDAILHHKEFQRVEARWRGLNYLVMNTETSTRLKLRVLNVKKDELRKDFEAAADFDR
SAVFKKVYEEEYGTFGGAPYGMLVGDYEFDGTNPDVSLLTELSKVAAAAHAPFIAAASPELFDMPSFTQI
GVPGDLAKIFESTQLIKWREFRESEDSRYVGLVLPHVLMRLPYGPKGVPVEGFNYEEQVGEGDGNFLWGN
AAYALTQRITNAFALYGWCAAIRGVEGGGLVENLPLHTFKTSEGDIVAKIPTEVAITDRRENELSELGFI
GLCYKKGSAQAAFFGGSTTNKPKAYNLPQANANARLSAQLPYILAASRFAHYVKVLMRDKIGSFSSQEGV
SNYLNNWIADYVLLNDTAGQETKARLPLREARVDVSEVPGKPGAYRAVVFLKPHFQLNELSVSMRLVAEL
PPPAA
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12990595-12989108 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGCGGAAGAGAGCACCCAAGCGGTCGGCTCGGCGGCGGCAGCGCCGGCCGAGGAGATGAGCCTCATCG
ACCAGATCCTCGCGCAGGGGATGGTCCGCGGCGCGGCGGAGCCGCAACGAAAGCACGCGCGCGATCTCAT
CGATGAGTTCGTGAACCAGGTCCTCGACGAGAAGGTGAAGGTCGGGAGCGACACGGTGGCGGCCATCGAG
GCGCGCATCGCCGAGATCGACGCGCGCATCAGCGCGCAGCTCGACGCCATCCTGCACCACAAGGAGTTCC
AGCGGGTGGAGGCGCGCTGGCGGGGGCTGAACTACCTCGTCATGAACACCGAGACCTCGACGCGGCTGAA
GCTGCGCGTGCTCAACGTGAAGAAGGACGAGCTGCGCAAGGACTTCGAGGCCGCGGCGGACTTCGACCGG
AGCGCGGTCTTCAAGAAGGTCTACGAGGAGGAGTACGGCACCTTCGGGGGCGCGCCGTATGGCATGCTCG
TCGGCGACTACGAGTTCGACGGCACGAACCCCGACGTCTCGCTCCTCACGGAGCTCTCCAAGGTGGCGGC
CGCGGCGCACGCGCCGTTCATCGCGGCGGCGTCGCCCGAGCTCTTCGACATGCCGAGCTTCACCCAGATC
GGCGTCCCCGGCGACCTCGCGAAAATATTCGAGAGCACGCAGCTCATCAAGTGGCGCGAGTTCCGCGAGT
CGGAGGACTCGCGCTATGTCGGGCTGGTCCTTCCGCACGTCCTCATGCGCCTGCCGTACGGGCCGAAGGG
CGTCCCGGTCGAGGGGTTCAATTACGAGGAGCAGGTCGGCGAGGGCGACGGGAACTTCCTCTGGGGGAAC
GCGGCGTACGCGCTCACGCAGCGGATCACGAACGCCTTCGCGCTCTACGGCTGGTGCGCCGCGATCCGCG
GCGTCGAGGGCGGCGGTCTCGTCGAGAACCTCCCGCTGCACACCTTCAAGACGAGCGAGGGGGATATCGT
CGCCAAGATCCCGACCGAGGTCGCCATCACCGACCGGCGCGAGAACGAGCTGTCGGAGCTCGGCTTCATC
GGGCTCTGCTACAAGAAGGGGAGCGCGCAGGCGGCCTTCTTCGGCGGCAGCACCACGAACAAGCCGAAGG
CGTACAACCTGCCGCAGGCGAACGCGAACGCCCGGCTGAGCGCGCAGCTCCCTTACATCCTCGCCGCGTC
CCGGTTCGCGCACTACGTCAAGGTGCTCATGCGCGACAAGATCGGGAGCTTCAGCTCGCAGGAAGGCGTC
TCCAACTACCTCAACAACTGGATCGCCGACTACGTGCTCCTCAACGACACCGCCGGCCAGGAGACCAAGG
CGCGGCTGCCGCTGCGCGAGGCGCGGGTCGACGTCTCCGAGGTCCCCGGCAAGCCCGGCGCGTACCGCGC
GGTGGTGTTCCTGAAGCCGCATTTCCAGCTGAACGAGCTCTCGGTCTCGATGCGGCTCGTCGCGGAGCTG
CCGCCGCCGGCGGCATGA
 Primer design