SecReT6
Protein ID: 162457628
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9342
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12990628..12991134 [-]
Producthypothetical protein
NoteTssB
UniProt IDA9GHL7
KEGG IDscl:sce9342
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-58, Aligned region: 9..164
Protein Sequence: 168 a.a.     [Download]
>gi|162457628|ref|YP_001619995.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MAESKQQWLSRNRPPRVQITYDVETGGAIEKKEIPFVVGIMTDLSGTSEAPRPKLKDRKFVEIDRDNFNE
VLAAVAPEATCLVDNKLTDEGGKLKVSLSFKSMDDFRPEQLVEQVEPLRALLRARERLNDLLAKLEGNDD
LSGMLRQVVEDTKKLETLKQELEKGRGG
 
Nucleotide Sequence: 507 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12991134-12990628 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGCAGAGAGCAAGCAACAATGGCTGAGCAGGAACCGCCCGCCTCGGGTGCAGATCACCTACGACGTCG
AGACCGGCGGCGCGATCGAGAAGAAGGAGATCCCGTTCGTCGTCGGGATCATGACGGACCTGTCGGGCAC
CTCCGAGGCGCCGCGGCCGAAGCTCAAGGACCGCAAGTTCGTCGAGATCGATCGCGACAACTTCAACGAG
GTCCTCGCCGCGGTGGCGCCCGAGGCCACGTGCCTCGTCGACAACAAGCTCACGGACGAGGGCGGCAAGC
TGAAGGTCAGCCTCTCCTTCAAGAGCATGGATGACTTCCGGCCCGAGCAGCTCGTGGAGCAGGTCGAGCC
GCTGCGCGCGCTGCTCCGCGCGCGGGAGCGGCTGAACGATCTGCTCGCGAAGCTCGAGGGCAACGACGAT
CTGAGCGGGATGCTCAGGCAGGTCGTCGAGGACACGAAGAAGCTCGAGACGCTCAAGCAGGAGCTCGAGA
AGGGCCGGGGCGGCTGA
 Primer design