SecReT6
Protein ID: 162457629
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9343
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12991269..12992321 [-]
Producthypothetical protein
NoteTssA
UniProt IDA9GHM0
KEGG IDscl:sce9343
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-20, Aligned region: 60..121
ImpA-rel_N [PF06812], Evalue: 2.20E-20, Aligned region: 131..142
ImpA-rel_N [PF06812], Evalue: 2.20E-20, Aligned region: 195..207
Protein Sequence: 350 a.a.     [Download]
>gi|162457629|ref|YP_001619996.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MAERTIAIDIERLLAPISQAAPAGAPLRYEGTYDRVREARREDDPTLPQGVWATRLKTADWKLVAELCAE
ALARRSKDLQIAAWLTDAWAQIGGIGAAAPGLRLIAELCDRYWDAMFPALDDDGLEARGDLVGWLDEALA
RRLRMVPLLEGSDERPPCTLADWESGRMDGGGPAEGARSAEPLAARLSLVDRSRWTALQRDARAALSAAE
ALERSLAARMDRPPVLHRTRGALRLLGAATASALGEPADDAPAPAAGEPSAQSAEDPAPARGPGPAIQSR
MEAYRRLNEAADYLLRTEPHSPVPYLVKRAISWGNMSLAELLGEFVSSADDLVAIYRLLGMRGREEGDAG
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12992321-12991269 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGGCAGAACGCACCATCGCAATCGACATCGAGCGCCTCCTCGCGCCCATCTCGCAGGCAGCGCCCGCCG
GGGCGCCGCTGCGCTACGAGGGCACCTACGATCGCGTCCGCGAGGCCCGGCGCGAGGACGATCCGACGCT
GCCGCAGGGCGTGTGGGCGACGCGCCTCAAGACGGCGGACTGGAAGCTCGTGGCCGAGCTCTGCGCCGAG
GCGCTCGCGCGGCGCTCCAAGGACCTGCAGATCGCCGCCTGGCTCACGGACGCGTGGGCGCAGATCGGCG
GGATCGGCGCGGCGGCGCCGGGGCTCCGGCTGATCGCGGAGCTCTGCGATCGCTACTGGGACGCGATGTT
CCCGGCGCTCGACGACGACGGCCTCGAGGCGCGCGGCGACCTCGTCGGCTGGCTGGACGAGGCGCTCGCG
CGGCGGCTCCGGATGGTCCCGCTCCTCGAAGGCAGCGACGAGCGCCCCCCCTGCACGCTCGCCGACTGGG
AGAGCGGCCGGATGGACGGCGGCGGCCCGGCCGAGGGCGCGCGCTCGGCCGAGCCCCTCGCGGCGCGGCT
CTCCCTCGTCGATCGCTCGCGATGGACAGCGCTCCAGCGCGACGCGCGCGCCGCCCTGTCCGCGGCCGAG
GCGCTGGAGCGGAGCCTCGCGGCGAGGATGGACCGCCCCCCGGTCCTCCACCGGACCCGCGGCGCGCTGC
GCCTGCTCGGCGCCGCGACGGCGTCCGCCCTCGGCGAGCCCGCCGACGACGCGCCGGCGCCCGCCGCGGG
AGAGCCCTCGGCGCAGAGCGCGGAGGACCCGGCGCCCGCGCGGGGTCCGGGCCCGGCGATCCAGAGCCGG
ATGGAGGCGTATCGCCGGCTCAACGAGGCGGCCGACTACCTCCTTCGCACGGAGCCGCACAGCCCCGTCC
CGTACCTCGTGAAGCGCGCGATCTCCTGGGGGAACATGTCGCTCGCGGAGCTGCTCGGCGAGTTCGTGTC
GAGCGCCGACGACCTCGTCGCGATCTACCGGCTGCTCGGCATGCGCGGCCGGGAGGAGGGCGACGCCGGA
TGA
 Primer design