SecReT6
Protein ID: 162457630
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9344
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12992350..12996357 [-]
Producthypothetical protein
NoteTssM
UniProt IDA9GHM2
KEGG IDscl:sce9344
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.50E-36, Aligned region: 131..379
AAA_16 [PF13191], Evalue: 5.50E-05, Aligned region: 40..191
AAA_16 [PF13191], Evalue: 5.50E-05, Aligned region: 564..697
AAA_16 [PF13191], Evalue: 5.50E-05, Aligned region: 1054..1147
Protein Sequence: 1335 a.a.     [Download]
>gi|162457630|ref|YP_001619997.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MTWPLAIALALLVAALVGLALLLRARRRRRAAGAAPTDDLEREMARLFTAARAALRASPDEIPCFLVLGA
AGAGKSTLLAGAGLTPRSGTTARSLGDPSTCQVWLFERAIFVEPAGRLLANEPQGGGTPRASGFRAVLEA
MRRARSERPVDGILVALSARDLLDSDGAAPAQQREIAHLRQRLDEAQQHLGMQVPVHLAITQSDRLDGFD
RFAHELDADLRQATLGWAQPGAAWVESTAGLVDEALGSVGAALSAMQARRLAADRPFAAGVEAYFLFPDA
LLALREPLRRSLEDLLRPNDDGEPVAVRSLSWVGLEPPAQPEPAQPATPSERPAGRRALFARDLLERKVI
AEACLARPTRLTLQRRQRVVRALRIATVAIALLYSVFLGLESNRLERHAASLLPFLSDLAASLRHMKLED
PSADPSGAVRAERSVRLLQGLSAIEGTRLRSALVPGSWLSGIDARIEQAIASAYERVILDAFRVGLHART
GPLFGEPPALLPAGAEIAAATLERTPEYVALEAWLREVAAFEGQVARFETLVAGPPKDPTTEAGDARVQS
VADLAESVLQHRLPPARTTAYQRRALLAIPPLSPFGLDAYRDPARARSDRLFSQLYQRISRTLDEAALRA
DVDALVRGLKELERGGPEYRSASLAALHDAIARTEARLAAPTLSWVAADRLPPNAALDRLLAAVRTLKLL
GDPAYGLVKDDGEGRLLLLKSYLGGAETALSGPLLVRKEGEVQLQLSPFVAALKEPSAALLRQRFMEPVD
NVDPLPATLDDARLSWNVEELKEGAKRLKEYEAFAQEEGLKRFPEKVRGTLGELALRNLRDNVLAAVGKA
ARREMAPPPSESRRVETVRADVGTLALASEPLREILAAAGRLGLEEVRDRVRALVRGQGAYLLTLASRTL
EADGLYEVKNGTFLWWNGERSPAFEAFGLADGDGAQLAEYAVAQRGRADALTRALAEPVLGLLESAEVAA
DARSVNGMAPWQHIVGALRDYEGKKAGNSVAALERFLLNDLPTVTFENCIAQIERVPVDVRSDDYFARRR
RRILVLLRDRCATLATEEIRTKYPSLRRSFHRSLADRFPFARLEPGVEREDANPDDVRLFLQSASDFRKR
FRPVLSLRGGAAARDVVRFLDRMEKVREFLAPMWAQGDATMDGSFDVTTAFRVNQAREVAGNQIAEWSLR
IAEERLFLGGPKPTATWRLGDPVQLTLRWAKNSPDIPSVEQNAGAVAKERTATFEASGPWALLRLIAMHT
HAAEEAELKKEDAVANILQLVVFTIPDPAGGWLERAGTTGGSARVFVRLGLVGKEKDKQLKYPDFPTTAP
VLDSE
 
Nucleotide Sequence: 4008 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12996357-12992350 Sorangium cellulosum 'So ce 56' chromosome, complete genome
GTGACGTGGCCCCTCGCGATCGCCCTCGCGCTGCTCGTCGCCGCGCTCGTCGGTCTGGCGCTGCTCCTCC
GCGCGCGGCGCCGGCGCCGCGCGGCAGGCGCCGCGCCGACCGACGATCTCGAGCGTGAGATGGCGCGGCT
CTTCACCGCGGCGCGCGCGGCGCTCAGGGCGTCGCCCGACGAGATCCCGTGCTTCCTCGTGCTCGGCGCC
GCCGGCGCCGGCAAATCCACGCTGCTCGCCGGCGCCGGGCTCACGCCGCGCTCCGGGACGACCGCGCGCT
CGCTGGGCGATCCGTCGACCTGCCAGGTGTGGCTCTTCGAGCGGGCGATCTTCGTCGAGCCGGCGGGGCG
GCTGCTCGCGAACGAGCCGCAGGGCGGCGGGACGCCGCGCGCGTCCGGCTTCCGCGCCGTCCTCGAGGCG
ATGCGGCGCGCGCGCTCCGAGCGGCCCGTCGACGGGATCCTCGTCGCGCTCTCCGCCCGCGACTTGCTCG
ACAGCGACGGCGCGGCGCCGGCCCAGCAACGGGAGATCGCCCACCTGCGCCAGCGGCTCGACGAGGCGCA
GCAGCACCTCGGGATGCAGGTCCCCGTCCACCTCGCGATCACGCAGAGCGACCGGCTCGACGGGTTCGAC
CGCTTCGCGCACGAGCTCGACGCCGATCTCCGCCAGGCGACGCTCGGCTGGGCGCAGCCGGGCGCCGCCT
GGGTCGAGAGCACCGCGGGCCTCGTCGACGAGGCGCTCGGCAGCGTCGGCGCAGCGCTCTCCGCGATGCA
AGCGCGCCGCCTCGCGGCGGACCGGCCGTTCGCGGCGGGCGTCGAGGCGTACTTCCTCTTTCCGGACGCG
CTCCTCGCGCTGCGCGAGCCCCTGAGGCGGTCGCTGGAGGACCTCCTCCGCCCGAACGATGACGGCGAGC
CCGTCGCGGTCCGGAGCCTGTCCTGGGTCGGCCTGGAGCCGCCGGCGCAGCCCGAGCCCGCGCAGCCCGC
GACGCCATCGGAGAGGCCGGCCGGGCGACGCGCGCTCTTCGCGCGCGATCTCCTCGAGAGGAAGGTGATC
GCCGAGGCCTGCCTGGCGCGCCCGACCCGCCTCACGCTGCAGCGCCGGCAGCGCGTCGTGCGGGCGCTCA
GGATCGCCACCGTCGCGATCGCGCTCCTCTACAGCGTCTTCCTCGGCCTCGAGAGCAACCGCCTGGAGCG
CCACGCCGCGTCGCTGCTCCCCTTCCTGAGCGACCTGGCGGCGAGCCTGCGCCACATGAAGCTCGAGGAC
CCCAGCGCCGACCCCTCGGGCGCGGTGCGCGCGGAGCGATCCGTCCGCCTGCTCCAGGGGCTGAGCGCGA
TCGAGGGCACGCGGCTCCGCTCCGCGCTCGTGCCCGGATCGTGGCTGAGCGGCATCGACGCGCGGATCGA
GCAGGCGATCGCGAGCGCCTACGAGCGGGTGATCCTCGACGCCTTCCGCGTCGGCCTCCACGCGAGGACG
GGCCCGCTGTTCGGGGAGCCCCCCGCGCTGCTCCCCGCGGGCGCGGAGATCGCCGCGGCCACCTTGGAGC
GCACGCCGGAGTACGTCGCGCTCGAGGCCTGGCTGCGCGAGGTGGCCGCGTTCGAGGGGCAGGTGGCGCG
CTTCGAGACGCTCGTGGCCGGACCGCCGAAGGATCCCACGACCGAGGCCGGCGACGCGCGCGTCCAGAGC
GTGGCCGATCTGGCCGAATCCGTCCTCCAGCACAGGCTCCCGCCCGCGCGCACGACGGCCTACCAGCGGC
GCGCGCTCCTCGCCATCCCGCCCCTCTCGCCCTTCGGCCTCGACGCGTACCGCGATCCGGCGCGCGCCCG
GTCCGATCGCCTCTTCAGCCAGCTCTACCAGCGCATCTCGCGGACGCTCGACGAGGCCGCGCTGCGCGCG
GACGTCGACGCGCTCGTCCGGGGCCTGAAGGAGCTCGAGCGCGGTGGCCCCGAGTACCGGTCCGCGAGCC
TCGCCGCGCTGCACGACGCGATCGCGCGCACCGAGGCGCGGCTCGCCGCGCCCACCCTCTCCTGGGTCGC
GGCCGACAGGCTCCCGCCGAACGCCGCGCTCGATCGCCTGCTCGCGGCGGTCCGCACCTTGAAGCTGCTC
GGCGATCCGGCCTACGGCCTGGTGAAAGACGACGGCGAGGGGCGGCTCTTGCTCCTGAAGAGCTACCTGG
GCGGCGCAGAGACAGCGCTCTCGGGGCCGCTGCTCGTGCGCAAGGAGGGCGAGGTGCAGCTCCAGCTCTC
GCCCTTCGTCGCCGCCCTCAAGGAGCCCTCGGCCGCGCTCCTGCGCCAGCGCTTCATGGAGCCCGTCGAC
AACGTCGATCCGCTGCCGGCGACCCTCGACGACGCGCGCCTGAGCTGGAACGTCGAGGAGCTCAAGGAGG
GCGCGAAGCGCCTCAAGGAGTACGAGGCGTTCGCGCAGGAGGAGGGGCTCAAGCGGTTCCCGGAGAAGGT
GCGCGGCACGCTCGGGGAGCTCGCCCTGCGCAACCTGCGGGACAACGTCCTCGCCGCGGTCGGCAAGGCC
GCGCGCCGGGAGATGGCCCCGCCTCCGAGCGAGTCGCGCCGCGTCGAGACGGTGCGCGCCGACGTCGGCA
CCCTCGCGCTCGCGAGCGAGCCGCTGCGGGAGATCCTGGCGGCCGCGGGGCGCCTCGGGCTGGAGGAGGT
GCGCGATCGCGTCCGCGCGCTCGTGCGCGGCCAGGGCGCGTACCTGCTCACCCTCGCCAGCCGGACGCTC
GAGGCCGACGGGCTCTACGAGGTCAAGAACGGGACGTTCCTCTGGTGGAACGGCGAGCGCAGCCCGGCGT
TCGAGGCGTTCGGCCTCGCGGACGGCGACGGGGCGCAGCTCGCGGAGTACGCGGTGGCGCAGCGGGGCCG
GGCCGACGCCTTGACCCGCGCGCTCGCCGAGCCCGTCCTCGGCTTGCTGGAGAGCGCCGAGGTCGCGGCC
GATGCCCGGTCCGTCAACGGCATGGCGCCGTGGCAACACATCGTCGGGGCGCTCCGCGATTACGAGGGGA
AGAAGGCCGGCAACAGCGTCGCCGCCCTGGAGCGCTTCCTCCTCAACGACCTGCCCACGGTCACGTTCGA
GAACTGCATCGCGCAGATCGAGCGCGTGCCGGTCGACGTGCGCTCCGACGACTACTTCGCCAGGCGGCGC
CGGCGCATCCTCGTCCTGCTCCGCGATCGGTGCGCCACGCTCGCCACGGAGGAGATCCGCACGAAATACC
CGAGCCTCCGCCGCTCGTTCCACCGCTCGCTCGCGGACCGCTTCCCCTTCGCGCGGCTCGAGCCGGGCGT
GGAACGGGAGGACGCGAACCCCGACGACGTGCGGCTCTTCCTTCAGAGCGCGAGCGACTTCCGCAAGCGC
TTCCGGCCCGTGCTGTCGCTGCGCGGCGGCGCCGCCGCCCGCGACGTCGTGCGCTTCCTCGACCGCATGG
AGAAGGTGCGCGAGTTCCTCGCGCCGATGTGGGCGCAGGGGGACGCGACGATGGACGGCTCCTTCGACGT
CACGACCGCCTTCCGCGTCAACCAGGCGCGCGAGGTGGCGGGCAACCAGATCGCGGAGTGGAGCCTGCGG
ATCGCCGAGGAGCGGCTGTTCCTGGGCGGGCCCAAGCCGACCGCCACCTGGCGGCTCGGCGACCCGGTCC
AGCTCACGCTCCGGTGGGCGAAGAACAGCCCCGACATCCCGTCGGTCGAGCAGAACGCCGGCGCGGTCGC
GAAGGAGCGGACGGCGACCTTCGAGGCGAGCGGCCCCTGGGCGCTGCTCCGGCTCATCGCGATGCACACG
CACGCCGCGGAGGAGGCGGAGCTGAAGAAGGAGGACGCCGTCGCCAACATCCTCCAGCTCGTCGTGTTCA
CGATCCCCGATCCCGCCGGCGGCTGGCTGGAGCGGGCCGGTACGACCGGCGGCTCGGCCCGGGTGTTCGT
GCGGCTCGGCCTCGTCGGCAAGGAGAAGGACAAGCAGCTCAAGTACCCCGACTTCCCGACGACCGCTCCG
GTGCTCGACAGCGAGTAG
 Primer design