SecReT6
Protein ID: 162457631
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9345
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12996354..12997130 [-]
Producthypothetical protein
NoteTssL
UniProt IDA9GHM5
KEGG IDscl:sce9345
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.20E-28, Aligned region: 36..234
Protein Sequence: 258 a.a.     [Download]
>gi|162457631|ref|YP_001619998.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
METPRREAPAPLQGSPVQALAGSTLLLDAFHAFYAEVVRQRQLVTLAHGGLAPGIETVRQRLVDFLETQA
VSLGRKLTKHELRAYDDAQYVMAAMADELLLQAEWDGRYAWAERPLEAHIFHTYVSGERIFRKLDDVLSG
HDAAPSALLLVYLAALALGFQGKYRALGLRDKPERYRQDLALHLQRVDPTLATGLTELCPQAHAHTLGGS
SRSRLPSLRAGVVPLAVVAGLLALAAQGVWLYRVDRVVEELDRIEGAP
 
Nucleotide Sequence: 777 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12997130-12996354 Sorangium cellulosum 'So ce 56' chromosome, complete genome
GTGGAGACGCCACGACGGGAGGCCCCGGCCCCTCTCCAGGGGAGCCCCGTGCAGGCGCTCGCGGGGAGCA
CGCTCCTGCTCGACGCCTTCCATGCGTTCTACGCCGAGGTCGTGCGGCAACGACAGCTCGTCACCCTCGC
GCACGGAGGGCTCGCGCCAGGCATCGAGACGGTGCGGCAGCGCCTCGTCGACTTCCTGGAGACCCAGGCC
GTCTCGCTCGGCCGCAAGCTCACCAAACACGAGCTCCGGGCCTACGACGACGCCCAGTACGTGATGGCCG
CCATGGCCGATGAGCTCCTCCTCCAGGCCGAATGGGACGGGCGGTACGCGTGGGCGGAGCGCCCGCTGGA
GGCGCACATCTTCCACACCTACGTCTCCGGCGAGCGCATCTTCCGCAAGCTCGACGACGTGCTCTCCGGG
CACGACGCGGCCCCCTCCGCGCTGCTGCTCGTCTACCTCGCCGCCCTCGCGCTCGGCTTCCAGGGCAAAT
ACCGCGCGCTCGGCCTGCGCGACAAGCCGGAGCGGTACCGGCAGGACCTGGCGCTCCACCTCCAGCGCGT
CGATCCCACCCTGGCCACCGGGCTCACCGAGCTCTGCCCCCAGGCCCACGCGCACACCCTCGGGGGCTCG
TCGCGGAGCCGGCTGCCGTCGCTGCGCGCCGGCGTCGTCCCGCTCGCCGTCGTCGCGGGCTTGCTGGCGC
TCGCCGCGCAGGGCGTCTGGCTGTACCGCGTCGATCGCGTGGTCGAGGAGCTCGACCGGATCGAGGGCGC
GCCGTGA
 Primer design