SecReT6
Protein ID: 162457632
SecReT6 ID249
T6SS typei4a
Gene symbol-
Locus tagsce9346
StrainSorangium cellulosum 'So ce 56'
Repliconchromosome [GenBank: NC_010162] [Browse all T6SS(s) in this replicon]
Location [Strand]12997151..12998494 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9GHM7
KEGG IDscl:sce9346
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-56, Aligned region: 23..412
Protein Sequence: 447 a.a.     [Download]
>gi|162457632|ref|YP_001619999.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
MRRPAEVPAAVQWHDGMLLSPQHFQEAARRSERLLDYHLGQLHPFHYGVHHLEIDAGLLASGTLRVLEVE
AVLPDHLVVHHTARDPELQVDLKPHAAELAAGPLTAYLAVPKEHLGGAATGGDLARYRSIEGAPVPDDNT
GEEPLPIPRLVPVARLLVAAAPPARFVCLPVAELRREGEAFVRTEYLPPSMTVPLTSPLGAMCGQITARL
REKALRLADRLSAHSRSKERDVLEELRRQIHALVTALPPFEVVLGTGRSHPYALYLALSSLVGHLAALAR
MPVPPVLPAYQHDDLRVTFSTARDHVFRLVDEGILESFTAHPFDFGEGRYLVEFQRRFAGRPVLVAVRGR
RGAQEKDVVSWVEGALIGSARRAREMQQSRVLGAGRRRVDRHGDLIAPAGTVLFELEPSSPYLDLGEPLL
IFNTGDPSAAAGPAELVLYVKATDERA
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|162448269|ref|NC_010162.1|:c12998494-12997151 Sorangium cellulosum 'So ce 56' chromosome, complete genome
ATGAGGCGCCCCGCGGAAGTACCCGCCGCCGTCCAGTGGCACGACGGTATGCTGCTCTCGCCGCAGCACT
TCCAGGAGGCCGCGCGGCGCTCCGAGCGCCTCCTCGATTACCACCTCGGGCAGCTCCACCCGTTCCATTA
CGGGGTCCACCACCTCGAGATCGACGCCGGGCTGCTGGCGAGCGGCACGCTGCGCGTCCTCGAGGTCGAG
GCCGTGCTCCCCGATCACCTCGTCGTCCATCACACCGCGCGCGATCCCGAGCTCCAGGTCGACCTCAAGC
CCCATGCCGCCGAGCTCGCGGCAGGCCCCCTCACCGCGTACCTCGCCGTGCCCAAGGAGCACCTCGGCGG
CGCCGCCACCGGCGGCGATCTCGCCCGCTATCGCTCGATCGAGGGAGCGCCGGTCCCGGACGACAACACG
GGAGAAGAGCCGCTCCCGATCCCGCGCCTCGTCCCGGTGGCGCGCCTGCTCGTCGCGGCCGCGCCGCCGG
CCCGCTTCGTGTGCCTGCCCGTCGCGGAGCTGCGGCGCGAAGGGGAGGCGTTCGTGCGCACCGAGTACCT
GCCGCCGAGCATGACCGTCCCCCTCACCTCGCCGCTCGGCGCGATGTGCGGCCAGATCACCGCGCGGCTG
CGCGAAAAGGCGCTGCGGCTCGCCGACAGGCTCAGCGCGCATTCTCGCAGCAAGGAGCGAGACGTGCTCG
AGGAGCTGCGCCGGCAAATCCACGCCCTCGTCACCGCCTTGCCCCCCTTCGAGGTCGTGCTCGGCACGGG
CAGATCTCACCCCTACGCCCTCTACCTCGCGCTCTCCTCCCTCGTTGGCCACCTCGCTGCCCTCGCCCGC
ATGCCGGTCCCGCCCGTCCTGCCCGCTTACCAGCACGACGATCTGCGGGTCACCTTCAGCACCGCGCGCG
ACCACGTCTTTCGCCTCGTCGACGAGGGCATCCTGGAGTCGTTCACGGCGCACCCCTTCGACTTCGGCGA
GGGGCGCTATCTCGTGGAGTTCCAGCGGCGCTTCGCCGGGCGGCCCGTGCTCGTCGCCGTGCGCGGCCGC
CGCGGGGCGCAGGAAAAGGACGTCGTGAGCTGGGTCGAGGGCGCGCTCATCGGCTCGGCGCGCCGCGCGC
GCGAGATGCAGCAGAGCCGCGTGCTCGGCGCCGGACGGCGGCGCGTCGATCGCCACGGGGATCTGATCGC
GCCCGCAGGGACCGTGCTCTTCGAGCTCGAGCCGTCGAGCCCCTACCTCGATCTCGGCGAGCCGCTCCTC
ATCTTCAACACGGGAGATCCCTCCGCGGCCGCCGGGCCTGCAGAGCTCGTCCTGTACGTGAAAGCGACCG
ACGAGCGAGCATGA
 Primer design