SecReT6
Protein ID: 16326459
SecReT6 ID897
T6SS typei5
Gene symbolimpI
Locus tagimpI
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]9606..10805 [+]
ProductImpI
NoteFha
UniProt IDQ93EC5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.50E-14, Aligned region: 29..95
Protein Sequence: 399 a.a.     [Download]
>gi|16326459|ref|AAL17781.1| ImpI [Rhizobium leguminosarum bv. trifolii]
MRLELKEITRDAAAPAGQSKWFFERGRRTLGRAPDCDWRLPEDRRSVSKLHCIIERDREGFLLRDQSANG
SRVDGVAVHEGQIVRLADRSRLELGGLAFSVHISGEKDREIEDPDAGLMLSDEPLTISAILADIAPGGHT
ANGILGERAVDDWGLPEKAGKKGAASSRNVEIGWSGPPEIRSVTQLLPEDWNSEETEYGSHLEHGSATHV
SAPITQRRPAPVIEIVSDNDPQAEPEAEEFPALTIGRPEAFADRLEPLLARLEEAVQNSYAVFEINAPSA
ASEPVFLAASSREEALFARTETLLGQQLKLNSALEALVQTAGRLEPRMLEARVETGAWRLPWGRDRAYWR
AYRAQFEQDGRSRSIHDVFRDAMTGAVNGTQAGPRPQDGQEGKDAHYEE
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|16326458|gb|AF361470|impI|:9606-10805
ATGCGGCTTGAACTGAAAGAGATCACCAGGGACGCGGCGGCGCCAGCAGGCCAGTCAAAATGGTTCTTCG
AACGCGGCCGGCGAACGCTCGGCCGGGCACCGGATTGCGACTGGCGCCTGCCGGAGGATCGGCGCTCCGT
TTCGAAGCTCCATTGCATCATCGAGCGCGACCGCGAAGGCTTCCTGCTGCGCGACCAGAGCGCAAACGGC
TCCCGGGTCGACGGCGTCGCCGTCCATGAGGGCCAGATCGTGCGGCTTGCCGACAGGTCGCGGCTGGAGT
TAGGCGGACTTGCCTTTTCCGTCCACATATCGGGCGAGAAAGACCGCGAGATAGAGGACCCCGATGCCGG
TCTCATGCTGAGTGACGAACCGCTGACCATCTCCGCAATCCTGGCCGATATCGCTCCGGGCGGTCATACC
GCAAACGGCATCCTTGGCGAGCGTGCGGTCGATGATTGGGGCCTTCCCGAAAAGGCCGGGAAAAAGGGAG
CGGCCTCATCCCGCAATGTCGAGATCGGCTGGAGCGGCCCTCCGGAGATCCGCTCAGTCACCCAGCTTCT
GCCGGAGGATTGGAATTCGGAAGAAACCGAATATGGCAGCCACCTGGAACATGGCTCCGCCACCCATGTT
TCCGCGCCCATCACTCAGCGCCGGCCGGCCCCGGTGATCGAGATCGTCAGCGACAACGATCCGCAGGCAG
AGCCGGAGGCCGAGGAGTTTCCGGCACTGACGATCGGCCGGCCCGAAGCCTTCGCCGATCGCCTGGAGCC
ACTGCTTGCCCGGCTCGAGGAGGCTGTCCAGAATAGCTATGCCGTTTTCGAGATCAATGCGCCATCCGCC
GCCAGCGAGCCGGTTTTCCTTGCCGCCAGCAGCAGGGAGGAAGCGCTTTTTGCCCGCACCGAAACCCTGC
TCGGGCAACAGCTCAAGCTCAATTCGGCGCTTGAGGCTCTGGTTCAGACAGCGGGCCGGCTGGAGCCGCG
CATGCTTGAGGCGCGGGTCGAGACCGGCGCCTGGCGCCTGCCCTGGGGCCGAGACCGGGCCTATTGGCGC
GCCTACCGGGCACAATTCGAACAGGACGGCAGGAGCCGGTCGATCCATGACGTTTTCCGCGACGCAATGA
CGGGGGCGGTAAACGGCACGCAGGCAGGGCCTCGTCCGCAAGACGGGCAGGAAGGAAAAGACGCGCATTA
TGAGGAATGA
 Primer design