SecReT6
Protein ID: 16326460
SecReT6 ID897
T6SS typei5
Gene symbolimpJ
Locus tagimpJ
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]10795..12135 [+]
ProductImpJ
NoteTssK
UniProt IDQ93EC4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-152, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|16326460|ref|AAL17782.1| ImpJ [Rhizobium leguminosarum bv. trifolii]
MRNENRVAWSEGMFLRVQHFQQADRWTERLVRTATHGLSPYPWGVAEIGIDRGALAIGQFALSNLRGVLP
DGTPFEAPVDTDLPPPLDLDENTKNAVVYLALPARQPGKADVALNGGAARNSVRLVASPYEAPDANVETD
FMAPIDVGRLSLRYLRTGDELAGYELIGLARIIEVRSDRAVILDPDYIVPSLNCTAAARLGELITELLGI
VRHRAEAIAERIGDPTIRGTAEVGDYLLLQMLNRADPMLKHISANATRIHPIVFYETCIQLAGELATFTT
DRKRASDFPPYRHDDLKATFAAVFDDLRASLSSVLEQAAVAIELAERRHGVRIGTINDRSLLRDAGFVLA
VRAEMPAEDVRRKLPAQIKIGPVERIADLVNVALPGIPVRPLPVLPRQLPYRSGTIYFELDTKNPLWKQL
DTSGAIAVHLAGDFPGLEIELWALRE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|16326458|gb|AF361470|impJ|:10795-12135
ATGAGGAATGAAAACCGGGTGGCCTGGAGCGAAGGCATGTTCCTTCGCGTGCAGCATTTTCAGCAGGCGG
ACCGCTGGACCGAGCGGCTCGTGCGCACGGCGACGCACGGCCTGTCGCCCTATCCCTGGGGAGTGGCGGA
AATCGGCATCGACCGCGGCGCACTGGCGATCGGCCAATTCGCGCTGTCGAACCTGCGCGGCGTATTGCCG
GACGGAACGCCGTTCGAAGCCCCTGTTGATACCGACCTGCCGCCGCCGCTCGATCTCGACGAGAACACCA
AGAATGCGGTCGTCTATCTCGCACTTCCCGCCCGTCAGCCGGGCAAGGCCGATGTGGCGTTGAACGGCGG
TGCCGCGCGCAACAGCGTCCGGCTCGTCGCGTCGCCCTATGAAGCGCCGGATGCCAATGTCGAGACCGAC
TTCATGGCGCCGATCGATGTCGGCCGTCTCAGCCTGCGCTATCTGAGGACCGGTGATGAACTCGCCGGCT
ACGAACTCATCGGACTTGCCCGTATCATCGAGGTGCGTTCCGACAGGGCCGTGATCCTCGATCCGGACTA
TATTGTGCCGAGCCTCAACTGTACGGCTGCTGCACGGCTCGGCGAGCTGATCACCGAACTGCTCGGCATC
GTGCGCCACCGCGCGGAGGCCATCGCCGAACGGATCGGCGATCCCACCATTCGAGGGACCGCGGAGGTCG
GCGACTACCTGCTCTTACAGATGCTCAACCGCGCGGATCCGATGCTGAAACACATTTCGGCGAATGCGAC
GCGGATCCACCCCATCGTCTTTTACGAGACCTGCATCCAGCTTGCCGGCGAGCTCGCCACCTTCACGACC
GACCGCAAGCGCGCGAGCGACTTCCCGCCTTACCGCCACGACGACCTGAAGGCGACGTTCGCGGCCGTCT
TCGACGATCTGCGCGCCTCGCTGTCATCAGTGCTCGAACAGGCAGCCGTGGCGATCGAGTTGGCCGAACG
CCGGCATGGCGTCAGGATCGGTACGATCAACGACCGTTCGCTGCTGAGAGATGCCGGCTTCGTTCTGGCG
GTCCGGGCCGAGATGCCGGCCGAAGACGTGCGCCGCAAGCTGCCGGCGCAGATCAAGATCGGCCCGGTTG
AGCGCATCGCCGACCTCGTCAACGTCGCGCTGCCGGGCATCCCCGTCCGGCCGCTGCCGGTGCTGCCACG
CCAGCTCCCCTATCGCTCCGGCACCATCTATTTCGAACTCGACACCAAGAACCCGCTTTGGAAACAACTC
GACACTTCGGGCGCCATCGCCGTGCATCTCGCCGGCGATTTTCCCGGGCTCGAAATAGAACTGTGGGCCC
TTAGAGAATGA
 Primer design