SecReT6
Protein ID: 16326461
SecReT6 ID897
T6SS typei5
Gene symbolimpK
Locus tagimpK
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]12132..13664 [+]
ProductImpK
NoteTssL
UniProt IDQ93EC3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-56, Aligned region: 78..282
OmpA [PF00691], Evalue: 4.20E-13, Aligned region: 107..131
OmpA [PF00691], Evalue: 4.20E-13, Aligned region: 372..469
Protein Sequence: 510 a.a.     [Download]
>gi|16326461|ref|AAL17783.1| ImpK [Rhizobium leguminosarum bv. trifolii]
MKNEPASTWQNLPTIVELTEDGTRKKQSARKMAEMLDDVLDFPESEGGKTPAGSLPKGAASVETLVRDFR
FGAEDVPTLVRSAAPLLNLAHGLRYTEEQPDIDELRQVAIEAVGRYERDLASARISPERARAAHYVICAT
VDDVVLSKAWGVRAGWARSGLVSTFHMDVTGGERVFDLLDHFHQSPGANKDLLLLIYLCLSLAFEGRTRV
SPRGGLELGRIRDGLYKTLLGQYGVFERELSPHWKGVSARHQPLRTAAAIWTLLSLLTLILALGYMFFTL
SLNRASDGTFERLARLPPRDMPSVLVKVPEPPRQQPPVVVAETPPPPPPPQVKPPSRLDNLLAFLQPEVE
KKLVTLSDSNGRLLVRISNSGLFATGSAEVSQKFHDLLQRIGGALAAENFRAVVVGYTDNVPIRTVQFPS
NWHLSEARAKAVGEILSSFTGPGAILTEGRADTDPIAANDTPEGREMNRRTEILVLTDPSERLNDAGLTT
PRRADMPDEPTAPAAGGGSR
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|16326458|gb|AF361470|impK|:12132-13664
ATGAAGAACGAACCCGCCTCCACCTGGCAGAACCTGCCGACCATTGTCGAACTTACCGAGGACGGCACTC
GGAAAAAGCAATCCGCCCGCAAGATGGCGGAGATGCTGGATGACGTCCTCGACTTTCCCGAAAGCGAGGG
CGGAAAGACGCCGGCGGGATCGCTTCCGAAGGGCGCAGCCTCCGTCGAAACGCTCGTCCGGGATTTTCGC
TTCGGAGCCGAAGACGTGCCGACGCTGGTGCGCTCGGCCGCACCGCTCCTCAACCTCGCCCATGGCCTGC
GCTACACGGAAGAACAGCCTGATATCGACGAACTGCGCCAGGTGGCGATCGAAGCCGTCGGCCGCTACGA
ACGCGATCTGGCGAGCGCCCGCATCAGCCCCGAACGAGCGCGCGCCGCCCATTACGTCATCTGTGCGACG
GTCGACGATGTCGTGCTCAGCAAGGCCTGGGGCGTTCGCGCCGGCTGGGCCCGCTCGGGGCTCGTTTCCA
CCTTCCATATGGACGTGACCGGCGGCGAACGGGTGTTCGACCTGCTCGACCATTTCCACCAGAGCCCCGG
CGCCAACAAGGACCTGCTTCTCCTCATCTATCTCTGCCTGTCACTTGCCTTCGAGGGCCGCACCCGCGTT
TCACCGCGCGGCGGGCTGGAGCTCGGCCGCATCCGCGACGGCCTTTACAAGACGCTGCTTGGCCAGTACG
GCGTCTTCGAACGAGAGCTTTCTCCCCACTGGAAGGGCGTTTCGGCCCGGCATCAGCCGTTGCGCACCGC
GGCCGCGATCTGGACGCTTCTTTCCCTTCTGACGCTGATCCTGGCGCTCGGCTACATGTTCTTCACGCTC
TCGCTCAATCGCGCCTCCGACGGAACGTTCGAGCGGCTCGCCAGGCTGCCGCCGCGCGATATGCCGAGCG
TACTCGTCAAGGTTCCGGAGCCGCCTCGGCAGCAGCCGCCCGTCGTCGTCGCCGAAACGCCGCCGCCGCC
GCCACCGCCGCAAGTGAAACCGCCGAGCCGGCTCGACAATCTGCTCGCCTTCCTCCAGCCGGAGGTCGAG
AAGAAGCTCGTCACACTCTCGGATTCGAATGGCAGGCTGCTGGTGCGGATCAGCAATTCCGGCCTGTTTG
CCACCGGCAGCGCGGAGGTCAGTCAAAAATTCCACGATCTTCTCCAGCGGATCGGCGGTGCGCTGGCCGC
AGAGAACTTCCGCGCCGTGGTGGTGGGTTATACCGACAATGTGCCGATCCGCACCGTGCAGTTCCCCTCC
AACTGGCACCTTTCCGAAGCCCGCGCCAAGGCGGTCGGCGAAATCCTGAGCTCCTTCACCGGGCCGGGTG
CGATCCTGACCGAGGGGCGTGCCGACACCGATCCGATCGCCGCCAACGATACGCCGGAGGGCCGGGAGAT
GAACCGCCGCACCGAGATCCTGGTCCTGACCGATCCGAGCGAGCGGCTGAACGATGCGGGTTTGACGACG
CCGCGTCGGGCCGACATGCCGGATGAACCGACGGCGCCCGCCGCAGGAGGTGGTTCGCGATGA
 Primer design