SecReT6
Protein ID: 16326462
SecReT6 ID897
T6SS typei5
Gene symbolimpL
Locus tagimpL
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]13661..17137 [+]
ProductImpL
NoteTssM
UniProt IDQ93EC2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.50E-71, Aligned region: 207..447
ImcF-related_N [PF14331], Evalue: 4.50E-71, Aligned region: 514..580
IcmF-related [PF06761], Evalue: 5.30E-70, Aligned region: 497..796
IcmF-related [PF06761], Evalue: 5.30E-70, Aligned region: 843..875
DUF1215 [PF06744], Evalue: 3.30E-35, Aligned region: 899..1020
Protein Sequence: 1158 a.a.     [Download]
>gi|16326462|ref|AAL17784.1| ImpL [Rhizobium leguminosarum bv. trifolii]
MNPLSYFYTLRSYVEAYAGLIGRRFISIIWVAAICVVIWFYGYLAVYGDFKPLASASARLTLIGIILAAW
LAYLVFTTIRDRRRDKQLVDGIERDAEAEAAASQQAEVGEIHGRLKEALQLLRRITKKRFGYIYELPWYV
IFGAPGSGKTTALTNSGLKFPLGDALGSNSVQGIGGTRNCNWWFTDEAILIDTAGRYTTQDDLNGTAKAG
WEGFLGLLRKYRRSQPINGALVTLSIGDLLTRDPEAQREEIRAIRQRLSELDELLHARVPVYLLLTKADF
LTGFVEFFDGFNKSDREQVWGTTFGLDESYKAANLPERFMEEFTLLQQRVDTMLIERLQQEPNPELRGRI
FRFPAELTSLKERLHEVVTELCSGSKLVEAPLLRGIYFASSTQREETVTVPRMRRSYFLSRLFKEVIFGE
ASLVARDKRLSGRQLLFRRAAYASAVLLLAVVLTSWTATYIQNTTALAGAERRIDAYEQLVRGVPVRDVS
DADFLRILPALDNLAAVTTDFSKTRVWPISLGLDQEGKVASRQREAYQRALNTLLLPRMLVQLQKDMTET
TDITRTFDALKLYGMLGGLGPVNADFASLEAEEMFTRLYPDEGRAAARQALIAHADVMARGALPPIELDK
ALIAKAREVIRSQNIANRAYDILAEYRESRALPAWSPAGALGPLGEQAFERTSKAPLNEGIPGLFSATGY
RTVVLPGITDAAREALDEQWVRGDPNPAGVTVDTIAQATLQLYFDAFEQRWSMILTDIRVKPSQTIGDAA
ETTRILAGKPGPVETITKSIVAATDLRAPGAEIASAAGDSLPASTTALASAANAPDPFGRLRDALKAPAG
QSSPDDQPKDAPRSEIGQLEPILQRVQEQLSRATTSTAEVAKVFDVDSQLTDANQDLLQQARKLPAPVDT
WMAGLAADVGSLAVKSARSRISDAWAAEGASFCSDVVAGRYPFDRKSPRDVAMSDFIRLFGPEGLFKTFF
KEKLEAFVDTSASPWGWKGTFGAVSIPSAAIAQFENADKINRAFFPAGSENPSISINVKPVSLTEAASAV
MLEIEGERVVYFHGPIQSKSITWPSTDASNVSRLAFQPGGWQQALTENGDWSPFRLFDDADLAIQGDDLF
RAKFRQNGQAAEFDVQFGSVLNPFRLEALGAFSCPAQF
 
Nucleotide Sequence: 3477 bp     [Download]
>gi|16326458|gb|AF361470|impL|:13661-17137
ATGAACCCGCTCAGTTATTTCTATACGCTCCGCTCCTATGTGGAGGCCTATGCCGGCCTCATCGGCCGTC
GCTTCATCTCGATCATCTGGGTGGCGGCAATCTGTGTCGTCATCTGGTTCTACGGCTATCTCGCCGTCTA
TGGCGACTTCAAGCCGCTGGCGAGCGCCAGCGCGCGGCTGACGCTGATCGGCATCATCCTCGCTGCCTGG
CTCGCTTATCTCGTCTTCACGACCATCCGCGACCGACGCCGCGACAAGCAGCTCGTCGACGGTATCGAGC
GAGACGCGGAAGCAGAAGCCGCGGCTAGCCAACAGGCTGAGGTCGGCGAGATCCACGGTCGGCTCAAGGA
AGCGCTGCAGCTGCTCCGCCGCATCACCAAGAAGCGCTTCGGCTATATCTATGAGCTGCCATGGTACGTC
ATCTTCGGCGCGCCGGGGTCCGGCAAGACGACGGCGCTCACCAATTCCGGCCTCAAATTCCCGCTCGGCG
ATGCGCTCGGCAGCAATTCGGTGCAGGGGATCGGCGGCACGCGCAACTGCAATTGGTGGTTCACCGACGA
GGCCATCCTCATCGACACGGCCGGCCGCTATACGACGCAGGACGATCTGAACGGCACCGCCAAGGCCGGC
TGGGAAGGATTTCTCGGCCTGCTGCGCAAGTACCGTCGTTCTCAGCCGATCAACGGCGCCCTGGTGACGC
TGTCGATCGGCGATCTCCTGACGCGCGATCCGGAAGCGCAGCGCGAGGAGATCAGGGCGATCCGCCAGCG
GCTTTCCGAACTCGATGAACTCCTGCATGCGCGCGTGCCGGTCTATCTGCTGCTGACCAAAGCCGATTTC
TTGACCGGCTTCGTGGAGTTTTTCGACGGTTTCAACAAAAGCGACCGCGAACAGGTCTGGGGCACGACGT
TCGGGCTCGACGAGAGCTACAAGGCGGCGAACCTGCCGGAACGCTTCATGGAGGAATTCACCCTGCTGCA
GCAGCGCGTCGATACCATGCTGATCGAACGCCTGCAGCAGGAGCCTAATCCGGAATTGCGCGGCCGCATC
TTCCGTTTCCCGGCCGAACTCACCTCTTTGAAGGAGCGTCTGCACGAGGTCGTCACCGAGCTTTGCTCGG
GTTCCAAGCTGGTGGAGGCGCCGCTGCTGCGCGGCATCTATTTCGCTTCCAGCACCCAGAGGGAGGAGAC
AGTCACCGTGCCCCGCATGCGGCGCAGCTATTTCCTCTCGCGCCTCTTCAAGGAGGTGATCTTCGGCGAG
GCCTCGCTGGTCGCCCGCGACAAGCGGCTTTCGGGGCGGCAACTGCTCTTCCGCCGCGCGGCCTATGCGA
GCGCGGTCCTGCTGCTTGCCGTGGTGTTGACCAGCTGGACGGCCACCTACATTCAGAACACCACGGCGCT
GGCCGGCGCGGAAAGACGCATAGACGCCTACGAACAACTGGTGCGTGGCGTGCCGGTTCGCGACGTTTCG
GATGCGGATTTCCTGCGCATCCTGCCGGCGCTCGACAATCTCGCCGCCGTCACCACCGACTTCTCGAAGA
CCCGCGTCTGGCCGATAAGCCTCGGCCTTGACCAGGAAGGCAAGGTCGCCAGCCGGCAGCGCGAGGCCTA
TCAGCGGGCGCTGAACACGCTGCTCCTGCCGCGCATGCTGGTGCAGCTCCAGAAGGACATGACCGAGACC
ACCGACATCACCCGCACCTTCGACGCGTTGAAGCTCTACGGCATGCTCGGCGGGCTCGGCCCGGTGAATG
CGGACTTTGCCTCGCTGGAAGCAGAAGAGATGTTCACGAGGCTCTATCCCGACGAAGGCAGGGCGGCGGC
CCGGCAGGCGCTGATTGCCCATGCCGATGTCATGGCGCGCGGCGCGCTGCCGCCGATCGAGCTCGACAAG
GCGCTGATCGCCAAGGCGCGCGAGGTCATCCGCTCGCAGAACATCGCCAACCGCGCCTATGACATCCTGG
CGGAATATCGCGAGTCCCGCGCGCTTCCCGCCTGGAGCCCGGCAGGCGCGCTGGGGCCGCTTGGCGAACA
GGCTTTCGAGCGCACCTCGAAGGCGCCGCTCAACGAAGGCATTCCCGGCCTCTTCTCCGCGACCGGCTAT
CGCACCGTCGTTCTGCCTGGGATCACCGACGCCGCGCGCGAGGCGCTCGACGAGCAATGGGTCCGCGGCG
ACCCCAATCCCGCCGGCGTCACGGTCGACACGATCGCCCAGGCGACGCTTCAGCTTTACTTCGACGCATT
CGAGCAGCGCTGGTCGATGATCCTCACCGATATCAGGGTGAAGCCTTCCCAGACGATTGGCGATGCGGCG
GAAACCACCCGCATCCTGGCGGGCAAGCCCGGCCCGGTCGAGACGATCACCAAATCAATCGTCGCTGCCA
CCGATCTACGCGCGCCCGGGGCGGAAATCGCCTCGGCCGCCGGCGACAGCCTGCCAGCCTCGACTACGGC
GCTTGCCAGCGCAGCGAATGCGCCCGATCCCTTCGGCCGTCTTCGAGATGCGCTGAAGGCGCCGGCCGGC
CAATCGTCGCCGGACGACCAGCCGAAGGATGCGCCGCGATCGGAGATCGGGCAGCTCGAGCCGATCCTGC
AGAGGGTCCAGGAGCAGCTTTCGCGCGCCACGACGTCGACGGCCGAAGTCGCGAAAGTCTTCGACGTCGA
CAGCCAGCTCACCGACGCCAATCAGGACCTGCTGCAGCAGGCGCGCAAGCTCCCGGCGCCGGTCGATACC
TGGATGGCGGGGCTGGCTGCGGATGTCGGATCGCTGGCGGTCAAATCCGCCCGATCACGCATCAGCGACG
CCTGGGCTGCCGAAGGCGCGAGCTTCTGCTCGGATGTCGTCGCCGGTCGTTATCCTTTCGACCGAAAATC
TCCGCGCGACGTGGCGATGAGCGATTTCATCAGGCTTTTCGGACCGGAGGGGCTGTTCAAGACCTTCTTC
AAGGAAAAGCTCGAAGCCTTCGTCGACACCAGCGCCTCGCCATGGGGCTGGAAGGGCACGTTCGGCGCGG
TGAGCATTCCGAGTGCGGCGATTGCCCAGTTCGAGAATGCCGACAAAATCAACCGCGCCTTCTTCCCGGC
CGGCAGCGAGAACCCGTCGATTTCAATCAACGTCAAGCCGGTATCGCTGACCGAGGCGGCCAGCGCCGTG
ATGCTGGAGATCGAGGGCGAACGGGTGGTCTATTTCCACGGGCCCATCCAATCGAAATCGATCACCTGGC
CGTCGACGGACGCCAGCAACGTTTCGCGCCTCGCCTTCCAGCCGGGCGGCTGGCAGCAGGCGCTGACGGA
GAACGGCGACTGGTCGCCCTTCCGGCTCTTCGACGATGCCGATCTCGCCATACAGGGCGACGACCTCTTC
CGGGCAAAGTTCCGGCAGAACGGGCAGGCAGCAGAGTTCGACGTGCAGTTCGGTTCGGTGCTCAATCCAT
TCCGGCTGGAGGCGCTCGGCGCCTTCTCATGCCCGGCGCAATTCTGA
 Primer design