SecReT6
Protein ID: 16326475
SecReT6 ID897
T6SS typei5
Gene symbolimpB
Locus tagimpB
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]1857..2402 [+]
ProductImpB
NoteTssB
UniProt IDQ93ED2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.30E-60, Aligned region: 15..169
Protein Sequence: 181 a.a.     [Download]
>gi|16326475|ref|AAL17797.1| ImpB [Rhizobium leguminosarum bv. trifolii]
MGRRRISMASVHEKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPTQPLKPFGERKFVQVD
RDNFDDVMRRMTPGLTLSVENTLEKNGTELPVSLKFESMADFEPGAVVDQVPGLKALLNARNQLRDLMSK
ADRSEELERLLEDILQNKADLSQLVAQLGGDKADEAKDALN
 
Nucleotide Sequence: 546 bp     [Download]
>gi|16326458|gb|AF361470|impB|:1857-2402
ATGGGACGAAGGAGAATCTCGATGGCAAGTGTGCATGAGAAACTGGAACGGGTTCGCAAACCGCGAGTCC
ACATCAAATACGAAGTGGAAACCGAAGGCGCGATGGTGGTGAAGGAACTGCCCTTCGTCGTCGGCGTGCT
CGGCGACTTCTCCGGAAATCCCACGCAGCCGCTCAAGCCTTTCGGCGAGCGCAAGTTCGTGCAGGTCGAC
CGCGACAACTTCGACGACGTCATGCGCCGCATGACGCCGGGCCTCACCCTGTCGGTCGAGAACACTCTCG
AGAAGAACGGAACAGAGCTTCCCGTTTCGCTGAAATTCGAAAGCATGGCCGATTTCGAACCCGGCGCGGT
CGTCGATCAGGTGCCGGGGCTGAAGGCCCTGCTCAACGCGCGCAACCAGCTGCGCGACCTGATGAGCAAG
GCGGACCGCTCCGAAGAGCTCGAGCGCCTGCTTGAGGATATCCTGCAGAACAAGGCCGATCTCTCGCAGC
TGGTCGCCCAGCTTGGCGGCGACAAAGCCGACGAGGCCAAGGACGCATTGAACTGA
 Primer design