SecReT6
Protein ID: 16326479
SecReT6 ID897
T6SS typei5
Gene symbolimpC
Locus tagimpC
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]2533..4014 [+]
ProductImpC
NoteTssC
UniProt IDQ93ED1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.70E-191, Aligned region: 64..490
Protein Sequence: 493 a.a.     [Download]
>gi|16326479|ref|AAL17801.1| ImpC [Rhizobium leguminosarum bv. trifolii]
MTAETQLQTKEDVGFAPDENLLSKVVAATRQTEPDRAQDLLRTLTDQALKGTVTYDRNLTITLNNAIAEI
DKAISGQLAAIMQSPEFTKLEGAWRGLNYLVKNSETSANLKIRVLNASKRDVAKDLAKAVEFDQSRLFKS
VYEDEFGTPGGEPMGALIGDYEFDNSFDDVQLLQGVSMIAAAAFAPFISAASPRMFGFEDFRELAKPRDL
EKIFETVEYAKWRSLRDSDDSRFVTLAMPRVLARMPYGPKTSPIEEFNFDETGGSKTGELSHGSYCWMNA
TYVMGTRLTEAFSKNGWCTAIRGAENGGKVEGLPMHIFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLP
LCHYKNTDYAVFFGAQTAHKPKLYDRPEATANAAVSARLPYMMATSRFAHYLKVMGRDKIGSFMEAEDCE
AWLNRWISNYVNANDDAGEESRAKYPLREAKVTVQEIPGRPGAYNAVAWMRPWLQMEELTTSLRMVARIP
SKN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|16326458|gb|AF361470|impC|:2533-4014
ATGACCGCCGAAACGCAATTGCAAACAAAGGAAGACGTAGGCTTCGCGCCTGATGAGAACCTGCTCTCGA
AGGTCGTTGCGGCAACCCGCCAGACCGAGCCAGACCGTGCCCAGGACCTTCTGCGCACCCTTACCGATCA
AGCCCTGAAGGGCACCGTCACCTATGATCGCAACCTGACGATCACCTTGAACAATGCCATCGCCGAAATC
GACAAGGCGATATCAGGTCAGCTCGCCGCCATCATGCAGTCGCCCGAGTTCACCAAGCTCGAAGGCGCTT
GGCGCGGCCTGAACTATCTCGTCAAGAACAGCGAGACCAGCGCCAATCTGAAGATCCGCGTCCTCAATGC
ATCCAAGCGCGATGTCGCCAAGGATCTGGCAAAGGCTGTCGAATTCGACCAGTCGCGGCTCTTCAAGTCG
GTCTATGAAGACGAGTTCGGCACGCCGGGCGGCGAACCGATGGGCGCGCTGATCGGCGATTACGAATTCG
ACAATTCCTTCGACGACGTCCAGCTTCTGCAGGGTGTGTCGATGATCGCCGCAGCGGCCTTCGCCCCGTT
CATCTCGGCCGCCAGCCCGCGCATGTTCGGCTTCGAGGATTTCCGGGAGCTCGCAAAACCCCGCGATCTC
GAGAAGATCTTCGAGACGGTTGAATACGCCAAGTGGCGCAGCCTGCGTGACAGCGATGATTCCCGCTTCG
TGACGCTCGCCATGCCGCGCGTGCTCGCCCGCATGCCCTACGGCCCGAAGACCAGCCCGATCGAGGAGTT
CAACTTCGACGAAACCGGCGGTTCCAAGACCGGTGAGCTGTCGCACGGTTCCTACTGCTGGATGAACGCA
ACCTATGTGATGGGCACGCGTCTCACCGAGGCCTTCTCCAAAAACGGCTGGTGCACTGCCATTCGCGGGG
CGGAAAACGGCGGCAAGGTCGAAGGGCTTCCCATGCACATCTTCTCGAGCGACGACGGCGATCTGGACCT
GAAATGCCCGACGGAAGTCGGTATCACCGATCGCCGCGACGCCGAACTCGGCAAGCTCGGCTTCCTGCCG
CTCTGCCATTACAAGAATACGGACTATGCCGTGTTCTTCGGGGCGCAGACCGCGCATAAGCCGAAGCTCT
ACGATCGGCCCGAGGCGACTGCGAACGCGGCCGTTTCAGCCCGCCTGCCCTATATGATGGCGACCTCGCG
CTTCGCCCATTATCTCAAGGTCATGGGCCGCGATAAGATCGGCTCCTTCATGGAGGCGGAAGATTGCGAG
GCCTGGCTCAATCGCTGGATCTCCAACTATGTCAACGCCAATGACGACGCCGGCGAAGAGTCTCGGGCGA
AATATCCGTTGCGCGAGGCAAAAGTCACCGTCCAGGAAATCCCCGGCAGGCCTGGCGCTTACAACGCCGT
GGCCTGGATGCGCCCGTGGCTGCAGATGGAGGAATTGACCACCTCGCTGCGCATGGTCGCCCGGATTCCC
TCGAAGAACTGA
 Primer design

Protein ID: 16326480
SecReT6 ID897
T6SS typei5
Gene symbolimpD
Locus tagimpD
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]4081..5469 [+]
ProductImpD
NoteTssC
UniProt IDQ93ED0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.00E-152, Aligned region: 12..443
Protein Sequence: 462 a.a.     [Download]
>gi|16326480|ref|AAL17802.1| ImpD [Rhizobium leguminosarum bv. trifolii]
MGSSTEWRRRADQLITLIDEALNKQVNAILHHPDFQAMEARWRGLAMLVREASRSGEVKVKLLGVTWSEL
TRTMERASDFDQSHLFELIYSREFGMPGGEPLGLLVGDYYLSPADPAGGDPVSTLSQIGMVAAAAFCPFV
AGAAPLAIGLEDFHELNRVNDFSWLANETARIRWNGLRAREDSRFLGLVAPRILMRSPLTPHSRNRNDGF
PFRESIAGDGSSLLWGNAAFAFATVVIRNFIDSGWFADIRGVTQDAVDGGLLSTAELPPYDFGTESNGLS
AQAPVEIHLTSGQEQQLCELGIIPAATTYLSSSAIFNSNQSLHAPPHYSNEHARQNARLAAMLQYVLCAS
RFSHYLKVIMRDEIGQLADAISIERKLADWLTAYTLGNDDADIALRTRFPLRSAGIGVAEIPGKPGSFSC
TVRLQPHFQLDDVATSFHLIAETATTGQILSRPVAIPERMSA
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|16326458|gb|AF361470|impD|:4081-5469
ATGGGTTCCAGCACTGAATGGCGGCGCCGGGCGGATCAGCTGATTACGCTGATCGACGAAGCGCTGAACA
AGCAAGTCAATGCCATCCTCCACCATCCCGATTTTCAGGCGATGGAGGCGAGATGGCGTGGCCTCGCCAT
GCTCGTGCGCGAGGCAAGCCGCAGCGGCGAAGTGAAAGTCAAGCTTCTCGGCGTCACGTGGAGCGAGCTC
ACGCGGACGATGGAGCGTGCCAGCGACTTCGACCAAAGCCACCTCTTCGAACTGATCTATAGCCGCGAGT
TCGGCATGCCGGGCGGCGAACCCCTCGGTCTGCTGGTCGGCGATTATTATCTTTCTCCGGCCGATCCGGC
CGGCGGCGATCCGGTCAGCACGCTGTCGCAGATCGGCATGGTGGCGGCCGCCGCATTCTGCCCCTTCGTC
GCGGGTGCTGCGCCGCTGGCGATCGGGCTTGAAGACTTTCACGAGCTGAACCGGGTCAACGACTTTTCCT
GGCTTGCCAATGAGACCGCCCGCATCCGCTGGAATGGTCTCCGCGCACGTGAGGATTCGCGTTTCCTCGG
ACTTGTCGCGCCGCGCATCCTGATGCGTTCGCCGCTCACGCCTCATTCGCGCAATCGCAACGACGGCTTT
CCCTTCCGCGAAAGCATTGCTGGCGACGGTAGTTCGCTTCTCTGGGGCAACGCCGCTTTCGCCTTTGCGA
CCGTCGTCATTCGCAATTTCATCGATTCCGGCTGGTTCGCGGATATCCGCGGCGTCACGCAGGATGCCGT
CGACGGTGGCCTGCTGAGTACAGCGGAATTGCCGCCTTATGACTTCGGCACAGAAAGCAACGGACTATCA
GCGCAGGCGCCGGTGGAGATCCATCTGACCAGCGGCCAGGAGCAGCAGCTCTGCGAGCTCGGCATCATCC
CTGCCGCGACCACCTATCTCTCCTCTTCGGCGATTTTCAATTCCAACCAGTCGCTGCACGCGCCGCCGCA
CTATTCCAACGAACATGCGCGCCAGAACGCCCGCCTCGCAGCCATGCTGCAATATGTGCTCTGCGCGTCG
CGCTTCTCGCATTATCTCAAGGTCATCATGCGCGACGAAATCGGCCAGCTTGCGGATGCGATCTCGATCG
AGCGGAAGCTGGCGGACTGGCTGACCGCCTATACGCTCGGCAACGACGATGCCGACATCGCGCTACGCAC
ACGCTTCCCCCTGCGCTCGGCCGGCATCGGCGTCGCCGAGATTCCGGGCAAGCCCGGCAGCTTCTCCTGC
ACCGTCCGGCTGCAGCCGCATTTCCAGCTCGACGACGTTGCCACGAGTTTCCATCTCATTGCCGAGACCG
CGACCACGGGCCAGATTTTGAGCCGCCCCGTTGCCATACCCGAGAGGATGTCCGCATGA
 Primer design