SecReT6
Protein ID: 16326481
SecReT6 ID897
T6SS typei5
Gene symbolimpE
Locus tagimpE
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]5466..6296 [+]
ProductImpE
NoteTagJ
UniProt IDQ93EC9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.60E-36, Aligned region: 141..262
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 12..66
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 115..133
TPR_16 [PF13432], Evalue: 0.0019, Aligned region: 12..66
TPR_16 [PF13432], Evalue: 0.0019, Aligned region: 115..149
TPR_14 [PF13428], Evalue: 0.0069, Aligned region: 15..43
TPR_14 [PF13428], Evalue: 0.0069, Aligned region: 35..68
TPR_14 [PF13428], Evalue: 0.0069, Aligned region: 113..144
Protein Sequence: 276 a.a.     [Download]
>gi|16326481|ref|AAL17803.1| ImpE [Rhizobium leguminosarum bv. trifolii]
MTLSASIAQSLSDNALDDAIEEVKAHLKVKPSDQEARHLYIDLLVLAGDYQRADNQCSLAATLSPDATMG
FALLRNELRAMAARDAWFTSGALPEFPQGPSELDKLAVRLGIAHRDGNADEARTTLDALEKLRGERPLIW
NGKAVSDFRDLDDRTPHALEVIMTGGGYLWIDFAKIAALSIEPIARPRDLAFRRAELSLIDGAAASVLLP
AVYHGTGKDETLRLGRETEWIEETTGITSGRGQRCYLAGDEMVSFHDTQSLEIVPAAAAGRQVAHG
 
Nucleotide Sequence: 831 bp     [Download]
>gi|16326458|gb|AF361470|impE|:5466-6296
ATGACGCTTTCCGCCAGCATCGCCCAATCGCTCAGCGACAATGCCCTCGATGACGCGATCGAGGAGGTCA
AGGCGCATCTGAAGGTCAAGCCCTCGGATCAGGAGGCGCGGCATCTCTATATCGATCTTCTCGTGCTTGC
CGGCGATTACCAGCGGGCGGACAATCAGTGCAGCCTTGCTGCCACCCTCTCACCCGACGCGACGATGGGT
TTCGCCTTGCTGCGCAACGAGCTTCGGGCGATGGCGGCGCGCGACGCCTGGTTTACGAGCGGCGCCCTGC
CGGAATTTCCGCAGGGGCCGAGCGAGCTCGACAAGCTCGCCGTCCGCCTCGGTATCGCCCATCGCGACGG
CAATGCGGATGAGGCGAGGACGACGCTCGATGCGCTCGAGAAGCTGAGGGGCGAACGTCCGTTGATCTGG
AACGGCAAGGCCGTCTCCGATTTCCGCGACCTCGACGACCGGACACCGCACGCTCTCGAAGTCATCATGA
CCGGCGGCGGCTATCTCTGGATCGATTTTGCCAAGATCGCAGCGCTCTCGATAGAGCCGATTGCCCGGCC
GCGCGATCTGGCCTTCCGCCGCGCCGAGCTCTCCCTGATCGACGGCGCAGCCGCGTCGGTGCTTCTGCCT
GCGGTCTATCATGGCACCGGCAAGGATGAGACGCTCAGGCTTGGCCGCGAGACCGAGTGGATCGAGGAGA
CGACCGGCATCACCAGCGGCCGTGGCCAGCGCTGCTACCTCGCCGGCGACGAAATGGTTTCCTTCCATGA
CACCCAAAGCCTGGAGATCGTGCCGGCAGCGGCTGCCGGCAGGCAGGTTGCGCATGGTTGA
 Primer design