SecReT6
Protein ID: 16326482
SecReT6 ID897
T6SS typei5
Gene symbolimpF
Locus tagimpF
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]6289..6798 [+]
ProductImpF
NoteTssE
UniProt IDQ93EC8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-18, Aligned region: 43..144
Protein Sequence: 169 a.a.     [Download]
>gi|16326482|ref|AAL17804.1| ImpF [Rhizobium leguminosarum bv. trifolii]
MVDPLERYRLRDRVLASSILDRLIDEAPDRTVDPPMSFVDQVRDVREAIRRDLEALLNTRRCPATPPAAL
SELRDALVSYGVDGVVSANLMTDQAKLKLAQAIERRIALFETRLSDVRVTILKSRTMTERALRMRIQATF
RLHEGMPPISFESTIDPSTQRFLVEAAHG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|16326458|gb|AF361470|impF|:6289-6798
ATGGTTGATCCGCTCGAACGCTACCGGCTGCGCGACCGCGTCCTTGCCAGCTCGATCCTCGACAGGTTGA
TCGACGAGGCTCCGGATCGCACCGTCGATCCGCCGATGAGCTTCGTCGATCAGGTCCGCGACGTCAGGGA
GGCGATCCGCCGCGATCTCGAAGCTCTGCTCAATACGCGGCGCTGCCCGGCCACACCGCCGGCGGCACTT
TCCGAACTCAGGGACGCGCTGGTGAGCTATGGCGTCGACGGCGTCGTCTCGGCAAATCTGATGACCGACC
AGGCCAAGCTCAAGCTGGCGCAAGCGATCGAGCGACGGATTGCGCTTTTCGAAACCCGGCTTTCCGATGT
GCGCGTGACGATCCTCAAGAGCCGGACGATGACCGAACGGGCGCTGCGCATGCGCATCCAGGCGACGTTC
CGCCTGCATGAAGGCATGCCGCCGATCAGCTTTGAGTCGACCATCGATCCCTCGACCCAGCGTTTCCTCG
TGGAGGCGGCGCATGGCTGA
 Primer design