SecReT6
Protein ID: 16326483
SecReT6 ID897
T6SS typei5
Gene symbolimpG
Locus tagimpG
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]6791..8572 [+]
ProductImpG
NoteTssF
UniProt IDQ93EC7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-193, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|16326483|ref|AAL17805.1| ImpG [Rhizobium leguminosarum bv. trifolii]
MAEGFLHRYNEELLALRRRAARFADAFPKIAGRLRMTGDVADDPHVERLIQSFAYSAARVRQKLDDEFPE
LTDGLLETLYPHYLAPLPSMSIVKFRPADTLASVQTVPRHTEVLAEPVRGEACRFRTTQDVEIAPIEITG
ANLSGQPINAPLSPYTGVAGCLRLSIRSLDARKPLGGLGMSRLRLHIPSPWQQAVAIYELLANHTLGIAL
AKHADDRSPVFLPAGNLKPVGFEPEEAMLPYPAPSFIGYRLLTEFFALPRKFLFLDIEGFDAWRGETLEL
FVYLGESDAKLERAVSVRDFALNATPVVNLFRQVCEPIAIDGTRTEYRLLPDARRQKTREIYSIDRVLLT
GSRGQEEFCQPFFGRSQRAGTSATYWQAYRRFDEDDRTSDMDIAFVNRQRRSSGPVDAVASVDTLCLNRD
LPEQLPFGGGHPFLQLASGHEAIASVEALIPPTPSVRMNDQEGRNWRLMSHLILNHLSLFDNDGAALKDI
LSLYAFRDSPETKQFVDALVRIKAGTSTARLGSGGTVPGTEIALEFDPAAIDRPSAFLFGSVLDRFFSLY
ASVNSFTRLTIRMKGQSRPIARWPARAAERPLL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|16326458|gb|AF361470|impG|:6791-8572
ATGGCTGAAGGTTTCCTGCACCGTTACAATGAGGAATTGCTGGCGCTTCGCCGCCGGGCCGCGCGCTTTG
CCGATGCCTTCCCGAAGATCGCCGGCCGCCTGCGCATGACCGGCGACGTCGCCGACGACCCGCATGTGGA
ACGCCTGATCCAGAGTTTCGCCTATTCGGCCGCCCGCGTCCGCCAGAAGCTGGACGACGAATTTCCCGAG
CTGACCGACGGCCTTCTCGAAACGCTTTATCCCCATTATCTGGCGCCACTGCCCTCGATGAGCATCGTCA
AGTTCCGCCCAGCCGACACGCTCGCCTCGGTCCAGACCGTGCCACGCCATACGGAAGTCCTGGCCGAGCC
GGTGAGAGGGGAAGCTTGCCGCTTCCGTACCACGCAGGATGTCGAGATCGCGCCGATCGAAATCACCGGT
GCTAATCTCTCCGGCCAGCCGATCAATGCGCCACTTTCGCCCTATACCGGCGTTGCCGGTTGCCTCAGGC
TGTCCATCCGCAGCCTCGATGCCCGAAAGCCGCTCGGCGGCCTTGGCATGAGCCGGCTGCGCCTGCACAT
TCCGTCCCCCTGGCAGCAGGCAGTGGCGATCTACGAACTGCTTGCCAATCATACACTCGGCATCGCACTT
GCCAAACATGCGGACGACCGTTCGCCGGTCTTCCTGCCGGCGGGCAATCTCAAACCGGTCGGCTTCGAAC
CAGAAGAGGCCATGCTGCCCTATCCGGCGCCGAGCTTCATCGGCTACCGGCTGCTAACCGAATTTTTCGC
TCTGCCGCGCAAATTTCTGTTTCTCGACATCGAAGGGTTCGATGCGTGGCGGGGGGAGACGCTGGAGCTC
TTCGTCTACCTCGGGGAAAGCGACGCCAAGCTCGAACGCGCAGTCTCGGTCCGCGACTTCGCGCTCAATG
CAACGCCCGTCGTCAACCTCTTCCGCCAGGTTTGCGAGCCGATCGCCATCGACGGCACCCGCACGGAATA
CCGCCTCCTGCCGGATGCGCGCCGCCAAAAGACCCGCGAGATCTATTCCATCGACCGCGTTCTCCTGACC
GGATCGCGCGGCCAGGAGGAATTCTGCCAGCCGTTCTTCGGACGGTCGCAACGGGCTGGCACGAGCGCAA
CCTACTGGCAGGCCTATCGCCGTTTCGACGAAGACGACAGGACCAGCGACATGGACATCGCCTTCGTCAA
CAGGCAGCGCCGTTCTTCAGGTCCTGTCGATGCGGTCGCAAGCGTCGATACGCTCTGCCTCAACCGCGAC
CTGCCGGAACAGCTTCCCTTCGGCGGCGGCCATCCATTCCTGCAGCTCGCTTCCGGCCATGAGGCGATCG
CCAGCGTCGAAGCCCTGATCCCGCCGACGCCGTCGGTCAGGATGAACGATCAGGAAGGGCGGAACTGGCG
GCTGATGTCGCATCTCATCCTCAATCACCTGTCGCTCTTCGACAATGACGGTGCGGCACTCAAGGATATC
CTGTCGCTCTACGCCTTCCGGGATAGCCCCGAGACCAAGCAATTCGTCGATGCGCTCGTCAGGATCAAGG
CGGGCACTTCGACCGCCCGCCTCGGCAGCGGCGGCACGGTGCCCGGCACCGAGATCGCGCTTGAATTCGA
TCCGGCCGCCATCGACCGGCCCTCGGCCTTCCTGTTCGGCAGCGTGCTCGACCGCTTCTTCAGTCTCTAC
GCCTCGGTCAACAGCTTCACCCGGCTCACCATTCGGATGAAGGGGCAATCGAGGCCGATCGCCCGGTGGC
CGGCACGCGCCGCCGAACGCCCGCTTCTCTAA
 Primer design