SecReT6
Protein ID: 16326484
SecReT6 ID897
T6SS typei5
Gene symbolimpH
Locus tagimpH
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]8593..9594 [+]
ProductImpH
NoteTssG
UniProt IDQ93EC6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.20E-70, Aligned region: 34..310
Protein Sequence: 333 a.a.     [Download]
>gi|16326484|ref|AAL17806.1| ImpH [Rhizobium leguminosarum bv. trifolii]
MDLPTARKPDALADLLERDPGRFEPVTAFRVAQASVGEGRLDVASHVGVSPAPLAVSGYKRKGGSATVRS
ALAGLVGALGSMPSAYNDLVMREERNRSRALAGFFDMFGARMAALFTDACEKYRIARRLRWGGAWANNAF
VTTLLSLTGFGTKRLVEKSGVDEELILRFSGFFAARNRNAVNLRAMLCEFSGLPVEIELFRGRWLTIPIE
ERSRIGQPQGVQLGVNATAGAAIHDFSGGFRIVIGPLGYADYLSLAPGGRAITELFALARLYVGAALEFD
IQAILKKEDVPFCQLGQAGDPPRLGWNSWARVAPAASDSGDAVIVERLSVQAR
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|16326458|gb|AF361470|impH|:8593-9594
ATGGATCTCCCGACCGCCCGCAAGCCAGACGCCCTTGCCGATCTGCTCGAACGCGACCCCGGCCGCTTCG
AGCCGGTGACGGCCTTTCGCGTCGCGCAGGCTTCGGTAGGGGAAGGACGGCTAGATGTCGCCTCGCATGT
CGGCGTCTCGCCGGCGCCTCTTGCCGTCAGCGGATATAAGCGCAAGGGCGGCAGTGCCACCGTCCGCAGC
GCGCTTGCCGGTCTCGTCGGGGCGCTCGGCTCGATGCCGTCGGCCTATAACGACCTCGTCATGCGCGAGG
AGCGCAACAGGTCGCGGGCGCTGGCGGGCTTCTTCGACATGTTCGGCGCGCGGATGGCGGCACTCTTCAC
TGACGCCTGCGAGAAATATCGTATCGCCAGGCGGCTGCGATGGGGCGGCGCATGGGCAAACAACGCCTTC
GTCACCACGCTCCTGTCACTCACCGGCTTCGGCACCAAACGTCTCGTCGAAAAGAGCGGCGTCGACGAGG
AACTGATCCTGCGTTTCTCGGGCTTCTTTGCCGCGCGCAACCGCAATGCCGTCAATCTCCGCGCCATGCT
CTGCGAATTCAGTGGCCTGCCGGTGGAGATCGAATTGTTCCGCGGCCGCTGGCTTACCATCCCGATCGAG
GAGCGCAGCCGCATCGGCCAGCCCCAGGGCGTCCAGCTTGGCGTCAATGCGACGGCAGGTGCTGCGATCC
ACGATTTCAGCGGCGGCTTTCGCATCGTCATCGGTCCGCTCGGTTATGCCGACTACCTCTCGCTCGCGCC
GGGCGGCCGCGCCATCACCGAACTCTTCGCCCTGGCGCGGCTCTATGTCGGTGCGGCGCTCGAATTCGAC
ATACAGGCGATCCTGAAGAAGGAGGACGTTCCCTTCTGCCAGCTCGGACAGGCGGGCGATCCGCCGCGGC
TTGGCTGGAACAGTTGGGCGAGGGTTGCGCCGGCTGCAAGCGACAGCGGCGATGCAGTGATCGTCGAGCG
CCTGTCGGTTCAGGCGCGGTGA
 Primer design