SecReT6
Protein ID: 16326486
SecReT6 ID897
T6SS typei5
Gene symbolimpA
Locus tagimpA
StrainRhizobium leguminosarum bv. trifolii
Replicon [GenBank: AF361470] [Browse all T6SS(s) in this replicon]
Location [Strand]744..1820 [+]
ProductImpA
NoteTssA
UniProt IDQ93ED3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.40E-17, Aligned region: 59..116
ImpA-rel_N [PF06812], Evalue: 4.40E-17, Aligned region: 185..205
Protein Sequence: 358 a.a.     [Download]
>gi|16326486|ref|AAL17808.1| ImpA [Rhizobium leguminosarum bv. trifolii]
MNVREIIDPLEQNHPCGENVRSNTAFREIYYRIKDARNAARTAERSIIPGETITIAPAWHDVSNLGLQLL
SSKSKDIEVLAWLAEAQLRLRGFSGLHDVYVATVSLLDKHFDALHSIGDGDVEERFAPFAGLNGVGGEGT
LIQAIRLTSLIPGGKFAQFSLWDFQLSQRPNETERRKELQQAAAEAGVAQMSAYLDVLTGCIAAFDRMVE
ILDEHCGDQAPPSSNTRNVLQEAASAIRMLAGIEAPTEAPLAAPQALASQGSEPLPASETDGSEAIGLRP
VSAEMIRSREEAFELLIAVARYFRRTEPHSPISMSIETLVRRGRMDFFELLAELLPEQQTRNAVLTAAGI
QPVADKGG
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|16326458|gb|AF361470|impA|:744-1820
GTGAACGTTCGCGAAATTATAGATCCACTTGAACAGAATCATCCGTGCGGAGAAAACGTGCGGAGTAATA
CTGCATTTCGTGAAATATACTATAGAATTAAGGACGCGAGAAACGCCGCGCGTACAGCCGAACGTAGTAT
TATCCCGGGTGAGACTATTACGATTGCACCTGCTTGGCACGATGTTAGCAATCTTGGATTGCAGCTCCTT
TCTTCAAAGAGCAAGGACATCGAAGTATTGGCATGGCTCGCAGAGGCGCAGCTGCGGCTGCGCGGCTTCT
CTGGATTGCATGACGTTTACGTCGCAACCGTGTCGCTTTTAGACAAGCATTTCGACGCTTTGCATTCGAT
CGGAGATGGTGACGTCGAGGAACGGTTTGCGCCGTTTGCGGGACTGAACGGCGTCGGCGGCGAAGGAACG
CTTATCCAGGCTATTCGTTTGACATCGTTGATCCCCGGCGGAAAGTTCGCGCAGTTTTCGCTTTGGGATT
TCCAGCTTTCGCAGCGGCCGAACGAAACCGAACGACGCAAGGAATTGCAGCAGGCGGCAGCGGAAGCCGG
TGTCGCTCAGATGTCAGCCTATCTCGACGTGCTGACCGGATGCATCGCCGCTTTCGATCGCATGGTCGAA
ATACTTGACGAACACTGCGGCGACCAGGCGCCACCGAGTTCGAATACACGCAATGTGTTGCAGGAGGCGG
CATCTGCAATCCGGATGCTGGCAGGAATCGAAGCGCCGACCGAAGCGCCCTTGGCCGCTCCGCAAGCCCT
TGCCTCGCAAGGATCCGAGCCACTACCGGCAAGCGAAACCGACGGGTCCGAAGCCATCGGCCTGCGGCCT
GTCAGCGCCGAGATGATTCGTTCACGGGAAGAAGCCTTCGAACTTCTGATCGCCGTTGCGCGCTATTTCC
GCCGCACCGAGCCCCATTCACCGATCTCCATGTCGATCGAAACGCTGGTGCGTCGCGGCCGCATGGATTT
TTTCGAGCTTCTTGCCGAGCTCCTGCCCGAACAGCAGACGCGCAACGCGGTGCTGACGGCAGCCGGCATC
CAGCCCGTAGCCGACAAGGGAGGCTAA
 Primer design