SecReT6
Protein ID: 163856773
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2461
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2582710..2586621 [+]
Producthypothetical protein
NoteTssM
UniProt IDA9IN86
KEGG IDbpt:Bpet2461
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-36, Aligned region: 169..343
ImcF-related_N [PF14331], Evalue: 1.10E-36, Aligned region: 354..396
ImcF-related_N [PF14331], Evalue: 1.10E-36, Aligned region: 556..607
ImcF-related_N [PF14331], Evalue: 1.10E-36, Aligned region: 747..777
ImcF-related_N [PF14331], Evalue: 1.10E-36, Aligned region: 1098..1134
ImcF-related_N [PF14331], Evalue: 1.10E-36, Aligned region: 1145..1165
SPOR [PF05036], Evalue: 1.60E-05, Aligned region: 1145..1154
SPOR [PF05036], Evalue: 1.60E-05, Aligned region: 1226..1286
Protein Sequence: 1303 a.a.     [Download]
>gi|163856773|ref|YP_001631071.1| unnamed protein product [Bordetella petrii DSM 12804]
MMFKKLLVLIAWLLGLLLLALGCWLAGLYFQWPLWQSAALFAGVLVAGALLAWLRRRWLAWRLRRKLAQP
VNAAAFDTRRLDADWRAGLRALKQSRLSRFGSPLYVLPWYLVLGPQEAGKSELLRRAAGASPVQAQGDDP
PVLQWWLLRRCVVLDPAAAMGEEHLAPASGNWRRLLHWMMRTRRREPLNGLILAFSAQWLMQSDETQRSE
TGRGLRTRLDELARVYDARIPVYIVLTDCQTLPGFAPWAAGLGPDVNGQAMGFLNTSPGAGVGEFIGDAF
NSIVHRMFDLRVLQGTRERPDDEAFALPERMAPLALRLANVLRPAFQATPYAETPLLRGLYLTGQPGGAD
RTAPAWFGPGLFEQVLPGQRHAWQPLERWRHWRRLLRHAVAVAWLLACVGVGVFLVHSSHVAQQELHAAN
LPGLDQKLDASGSVSSNLHALQAVRGAVHSLRQRPRWEQRWLPFQRRVNHIQDILANSYVQSFHQAVIVG
HLDPLLSTSLPQLDAKQDDKLLAAWVQTLVRRINLLDAALNGKDVYALPAPGGEMTLLFASAKNPPPNPI
DGALLGEMYQDYLTWQTHREVLLSERRALQQVLASLNLTERSRGWLYAWVDLQGNLRPVRLTDFWDIAAQ
PGQPYVPAALTPAGEQAVSSFAAELGRASGNSELWAERSKEFRQNYLQAGLDAWYAFADAFASAPNQLAD
GTARREVMSTLFTANGPYRRLLGLLAQVGQLWPAQSRPDWMQQAIQINELQSLAAEQSQQRTGAAAGVKQ
RLQVVQQFGSSMLQELPARGGSISDGLAELHMDKDALSLLAAYRKDVLATIVPLQQGDGNAMKAAIDIWS
FGHDPNVKSPPLIDAGTALDKLRKLAGGKAGPRTSVVWKLLSGPLDFTLDYAGRNVACRLQQSWENSVLS
VIQGVDDADLANDMLFGDRGQVKAFMGGDVKNFIEQNGNQYQGRAALGHVVPFNGQFYAFASLSQLRQVT
LASQQMQSKRSQDEAQALGKQQQDLEAQIAKLEATTANVTLSTVPPQTNPGARALPESITLSLQCASGRI
TLENLNFPNKAAFPWAMANCGDTALSIRYAGFELNRQWSGARGFIDFLKEFSSGQRRYTPADFPDQAASM
QQAGVQWIAVTYQQQGQAPLVAAFADADKLAAQAGEVKARLEKLQPGTAPGSTVPPPRPAPALPRQIVSV
CMGPTASLMPAPEPAPAPAPGPSTAVPAAPATSVDSGYAVQVGIFAHPDPVRAQLALNGFEATEAAITLK
GHAYTRIRVEGLASEQAAQAAAEKIGRLLKLKPAVLHNGKVLD
 
Nucleotide Sequence: 3912 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2582710-2586621 Bordetella petrii DSM 12804 chromosome, complete genome
ATGATGTTCAAGAAACTACTCGTGCTGATTGCCTGGTTGCTGGGCCTGCTGTTGCTGGCGCTGGGGTGCT
GGCTGGCCGGCCTCTACTTTCAGTGGCCGCTATGGCAGTCGGCCGCCTTGTTTGCCGGGGTGCTCGTCGC
CGGGGCGCTGCTGGCCTGGCTGCGGCGCCGCTGGCTGGCCTGGCGGCTGCGCCGCAAGCTGGCGCAGCCG
GTCAATGCCGCGGCCTTCGACACGCGGCGCCTGGACGCTGACTGGCGCGCCGGCCTGCGCGCCCTGAAGC
AGTCGCGCCTGTCCCGTTTCGGTTCGCCTTTGTATGTGCTGCCGTGGTACCTGGTGCTGGGCCCGCAGGA
GGCGGGCAAGTCTGAACTGCTGCGTCGCGCCGCCGGCGCCAGCCCGGTACAGGCGCAGGGCGATGATCCG
CCCGTCCTGCAATGGTGGCTGCTGCGGCGCTGCGTGGTGCTGGACCCCGCGGCAGCCATGGGAGAAGAGC
ATCTCGCGCCCGCCTCGGGCAACTGGCGGCGCCTGCTGCACTGGATGATGCGGACTCGCCGGCGTGAACC
GCTCAATGGCCTGATCCTGGCGTTCAGCGCCCAGTGGCTGATGCAAAGCGACGAGACGCAGCGCAGCGAA
ACCGGCCGGGGCCTGCGCACGCGGCTGGACGAACTGGCGCGGGTCTATGACGCGCGCATTCCCGTGTATA
TCGTGCTGACCGACTGCCAGACCTTGCCGGGATTCGCGCCATGGGCGGCCGGCCTGGGGCCTGATGTCAA
CGGCCAGGCAATGGGGTTTCTGAACACCTCGCCCGGCGCGGGCGTGGGCGAGTTCATTGGCGATGCCTTC
AACAGCATCGTGCACCGCATGTTCGATTTGCGCGTGCTGCAGGGCACCCGCGAGCGGCCCGACGACGAGG
CGTTCGCCCTGCCCGAACGCATGGCGCCGCTGGCGCTGCGGCTGGCCAACGTACTGCGGCCCGCTTTCCA
GGCTACGCCCTATGCCGAGACCCCGCTGCTGCGCGGCCTGTACCTGACGGGGCAGCCGGGTGGCGCCGAC
CGCACCGCGCCCGCCTGGTTCGGCCCTGGTCTGTTCGAGCAGGTATTGCCCGGGCAGCGGCATGCCTGGC
AGCCGCTGGAGCGCTGGCGCCACTGGCGCCGGCTGTTGCGGCACGCCGTGGCCGTGGCCTGGCTGCTGGC
GTGCGTCGGAGTGGGCGTCTTCCTGGTCCATTCGAGCCACGTGGCGCAACAGGAGCTGCATGCAGCCAAT
CTGCCGGGGCTGGACCAGAAGCTGGATGCGTCGGGATCGGTTTCCAGCAACCTGCACGCGCTGCAGGCCG
TACGCGGCGCCGTGCACAGCCTGCGGCAGCGCCCGCGCTGGGAGCAGCGCTGGCTGCCCTTCCAGCGCCG
GGTCAACCACATCCAGGACATACTGGCCAACAGCTATGTGCAGAGTTTCCACCAGGCCGTGATCGTCGGC
CATCTCGATCCGCTGCTCAGCACCAGTCTGCCGCAGCTGGATGCCAAGCAGGACGACAAATTGCTGGCGG
CCTGGGTTCAGACTCTGGTGCGCCGCATCAACCTGCTCGATGCCGCCCTGAACGGCAAGGACGTCTACGC
GCTGCCGGCGCCGGGCGGTGAAATGACGCTTCTGTTCGCCAGCGCCAAGAATCCGCCGCCCAATCCTATC
GATGGCGCGCTGTTGGGCGAGATGTACCAGGATTACCTGACCTGGCAAACACACCGCGAAGTGTTGCTTT
CCGAGCGACGCGCTTTGCAGCAAGTGCTGGCCAGCCTGAACCTGACCGAGCGCTCGCGAGGATGGCTGTA
CGCCTGGGTTGACTTGCAGGGCAACCTGCGGCCGGTGCGGCTGACCGATTTCTGGGATATCGCGGCGCAA
CCCGGGCAGCCCTACGTGCCAGCCGCCCTGACGCCCGCCGGCGAACAGGCCGTGTCGAGTTTCGCCGCTG
AACTGGGGCGCGCATCGGGCAACAGCGAGCTGTGGGCCGAGCGCAGCAAGGAGTTCCGCCAGAATTACCT
GCAGGCGGGGCTGGACGCCTGGTACGCCTTCGCGGATGCCTTTGCGTCGGCGCCGAACCAATTGGCCGAC
GGCACGGCGCGCCGCGAGGTCATGTCGACCCTATTCACCGCCAATGGTCCGTACCGCCGTCTGCTCGGTT
TGCTGGCGCAGGTCGGACAACTGTGGCCCGCCCAGTCGCGTCCCGACTGGATGCAGCAAGCCATCCAGAT
CAATGAACTGCAGTCCCTGGCCGCCGAGCAAAGCCAGCAGCGCACTGGCGCCGCCGCGGGCGTGAAGCAA
CGCCTGCAAGTCGTGCAACAGTTCGGCAGCAGCATGCTCCAGGAACTGCCCGCGCGGGGCGGCTCGATAT
CGGACGGGTTGGCCGAGCTGCACATGGACAAGGATGCCCTGAGCTTGCTGGCGGCCTATCGCAAAGACGT
GCTGGCGACGATCGTGCCGCTGCAGCAAGGCGATGGCAACGCCATGAAAGCGGCGATAGACATCTGGTCG
TTCGGGCATGACCCCAATGTGAAATCGCCACCGCTTATCGACGCCGGCACTGCGCTGGACAAGCTCAGGA
AACTGGCCGGGGGCAAGGCCGGGCCGCGCACCAGCGTCGTCTGGAAGTTGCTGTCGGGGCCACTGGATTT
CACCCTGGATTACGCGGGTCGCAATGTGGCCTGCCGCCTGCAGCAAAGCTGGGAGAACTCGGTGCTGAGC
GTTATACAGGGCGTGGACGACGCCGACCTGGCCAACGATATGTTGTTTGGCGACCGTGGCCAGGTAAAGG
CATTCATGGGGGGCGATGTCAAGAATTTCATCGAACAGAACGGAAATCAATACCAGGGACGTGCCGCCCT
GGGGCATGTGGTTCCGTTCAATGGGCAGTTCTATGCCTTTGCCAGTCTGTCGCAATTGCGGCAGGTCACG
CTGGCCAGCCAGCAGATGCAGTCCAAGCGCTCGCAGGATGAAGCCCAGGCCCTGGGCAAACAGCAACAGG
ACCTGGAGGCCCAGATTGCCAAGCTCGAGGCCACCACGGCCAACGTGACGCTGAGCACGGTGCCGCCTCA
GACCAATCCGGGCGCGCGCGCCCTGCCGGAAAGCATTACGCTCAGCCTGCAATGCGCCAGCGGCCGCATC
ACTCTGGAAAATCTGAACTTTCCGAACAAGGCCGCGTTCCCGTGGGCGATGGCCAATTGCGGCGATACGG
CGCTCAGTATCCGCTATGCGGGCTTTGAGTTGAACCGGCAATGGAGCGGCGCGCGCGGCTTCATAGACTT
CCTGAAGGAGTTCTCCAGTGGGCAGCGGCGTTATACGCCCGCCGATTTTCCCGACCAGGCTGCGTCGATG
CAGCAGGCCGGCGTGCAGTGGATTGCGGTGACCTATCAGCAGCAAGGGCAGGCGCCTCTGGTCGCGGCAT
TTGCCGACGCGGACAAGCTGGCCGCCCAAGCCGGCGAAGTCAAGGCGCGCCTGGAAAAACTGCAGCCGGG
CACTGCGCCTGGCTCGACCGTGCCACCGCCGCGGCCCGCTCCCGCCTTGCCGCGGCAGATCGTCTCGGTC
TGCATGGGTCCGACCGCCAGCCTGATGCCGGCACCCGAGCCCGCGCCAGCCCCGGCGCCGGGGCCGTCAA
CGGCGGTCCCGGCCGCACCGGCCACGTCCGTGGACAGTGGCTACGCCGTGCAAGTGGGCATCTTCGCGCA
TCCCGATCCTGTACGCGCGCAATTGGCGCTCAACGGGTTCGAAGCGACTGAAGCCGCGATCACGCTGAAG
GGCCATGCCTACACGCGCATTCGCGTCGAGGGACTGGCCAGCGAGCAGGCGGCGCAGGCCGCGGCGGAAA
AAATCGGGCGCCTGCTCAAGCTGAAGCCGGCGGTGCTGCATAACGGAAAGGTGCTGGACTGA
 Primer design