SecReT6
Protein ID: 163858420
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4102
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4336908..4340519 [-]
Producthypothetical protein
NoteTssM
UniProt IDA9I7V0
KEGG IDbpt:Bpet4102
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-98, Aligned region: 83..125
ImcF-related_N [PF14331], Evalue: 4.30E-98, Aligned region: 205..473
ImcF-related_N [PF14331], Evalue: 4.30E-98, Aligned region: 1057..1073
IcmF-related [PF06761], Evalue: 4.50E-89, Aligned region: 522..832
DUF1215 [PF06744], Evalue: 6.30E-33, Aligned region: 941..1065
Protein Sequence: 1203 a.a.     [Download]
>gi|163858420|ref|YP_001632718.1| unnamed protein product [Bordetella petrii DSM 12804]
MIHNVFGFLFSRGLWNFFGLVALALLIWIAGPLLAIGATRPLESETTRIIVIAVLFGLWLLRILWRKWRE
GRLNAQLLGQLRKPATKKKAEPEPGNPEIRQLEERFNEAVELLRKTRFEGNKRRLSLDRFSKQYLYQLPW
YVIIGAPGAGKTTALVNSGLNFPLADRFGKVALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDATGDE
EEWKGFLRLLSKFRGRQPINGAMLTVSVEDLLAASDAERVQHAAVLRRRLQELREQLGIQFPVYVLVTKA
DLLSGFEEYFASFNREDLSQVWGFTLPYTRTQEADFDLYDAFHAEYELLKRRLDDALPEVLAAETDASRR
ALAYMLPQQFAGLQAVLGHFLSDVFATSKYEARLVPRGVYFTSGTQGGETFDQVTGYLKRYLRIDGGPAP
AASVPGEGDGRSYFLKGLLQDVIFREAGLAGRNLRWERRYRRLHWAGYGLIAALFVALLVGWVVSYRSNK
AYVAEVSRRVPTVEKLGRDIKITQAGDVLGLMPFLDSLWYLPRHANFELDSPPLNYQFGLYQGQKVQAAA
QGVYRGTLEQVLVPQIARRVETALRKAAPDDLEFSYEALRAYLMLYEADHYDAEFMHAWLLSDMQKTLPE
GYTRRQYDLMSLHLRNLVQGRVLSSPFPRDDELVKQARERLARYTLAQRAYSRLRRMLANTDQGPQQTAI
TLGGPQASAVFVRKSGKPLTDGIPSLYSYNGYWKVFNQRVTRVADLLRQDDAWVLNIEAPGILDQRAQQQ
LIVDIKRLYMNDYVEQWDGYLNDLQLAPTTSLLQNIQMARTLSAPESPLVKLVQGVARETSLLRDTGDGQ
SLMDQARNRVSSTREALEQMFGPTGPSAAMRADASDEKLERIVDLHFEPYRRLAQSDGQGAPPAITATTG
LINELYTYLTAADAALRSASPAPGSDVVTKLRAEAGRLPEPLRDLLNTLSVKASGEISEATRERMGDTVT
ATIGVFCRQSIAGRYPFASGSSRDVAPNDMARLFGPNGMMDDFFQKHLASQIDVSGSRWRFKPGIDGKQG
DKAAYLDSFQRASVIRDVYFTAGNPLPSYRVAIRPLEMDAQITQFLMDVDGQTVRYAHGPQVATNVQWPG
PRGTNQARIELTPQAGPAGLSASGPWALNRLLDKAQLRRGSSPEVTIATFDINGRKVVLEITASSVKSPF
HLAEMQGFACPGK
 
Nucleotide Sequence: 3612 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4340519-4336908 Bordetella petrii DSM 12804 chromosome, complete genome
ATGATTCATAACGTATTCGGTTTCTTGTTCAGCCGGGGCTTGTGGAATTTCTTCGGCCTGGTGGCCCTGG
CGCTGCTGATATGGATCGCCGGCCCGTTGCTTGCCATCGGCGCGACGCGGCCGCTGGAAAGCGAGACGAC
GCGCATCATCGTCATCGCCGTGCTGTTCGGCCTGTGGCTGCTGCGCATCTTGTGGCGCAAATGGCGCGAA
GGCCGCCTGAACGCGCAACTGCTGGGCCAGTTGCGCAAGCCGGCAACCAAGAAAAAGGCCGAGCCCGAGC
CCGGCAACCCCGAGATCCGCCAGCTGGAAGAGCGCTTCAATGAGGCGGTGGAGTTGCTGCGCAAGACGCG
CTTCGAGGGCAACAAACGGCGCCTGTCGCTCGACCGCTTTTCGAAGCAGTACCTGTACCAGCTGCCCTGG
TACGTGATCATTGGCGCGCCGGGGGCCGGCAAGACCACGGCCCTGGTGAATTCCGGCCTGAATTTCCCGC
TGGCCGACCGCTTTGGCAAGGTAGCGCTGCGCGGGGTGGGCGGCACGCGCAACTGCGATTGGTGGTTCAC
CGACGATGCAGTGTTGCTGGATACCGCCGGCCGTTACACCACCCACGAAAGCGACGCCACCGGCGACGAG
GAAGAGTGGAAGGGCTTTTTGCGGCTGCTGTCGAAATTCCGCGGCCGCCAGCCCATCAATGGCGCGATGC
TGACTGTCAGCGTCGAAGACCTGCTGGCCGCGTCCGATGCCGAGCGCGTGCAGCACGCGGCGGTGCTGCG
GCGCCGGCTGCAAGAGCTGCGCGAGCAGCTGGGTATCCAGTTTCCGGTATATGTGCTGGTGACCAAGGCC
GACCTGCTGTCGGGCTTCGAGGAGTACTTCGCATCGTTCAACCGCGAAGACCTGTCGCAGGTGTGGGGCT
TCACGCTGCCGTACACCCGCACGCAGGAAGCGGATTTCGATCTGTATGACGCCTTCCACGCCGAGTACGA
ATTGCTGAAGCGGCGCCTGGACGATGCGCTGCCCGAAGTGCTGGCCGCCGAAACCGACGCATCGCGCCGC
GCGCTTGCCTATATGCTGCCGCAGCAGTTCGCCGGACTGCAGGCGGTACTGGGGCACTTCCTGAGCGACG
TGTTCGCCACCTCGAAGTACGAGGCGCGCCTGGTGCCGCGCGGCGTGTATTTCACCAGCGGCACGCAGGG
TGGCGAGACGTTCGACCAGGTTACCGGCTATCTGAAGCGCTATCTGCGCATCGACGGCGGGCCGGCGCCC
GCGGCCAGCGTGCCGGGCGAAGGCGACGGCCGCAGCTACTTCTTAAAGGGCCTGTTGCAGGACGTGATTT
TCCGCGAGGCGGGCCTGGCCGGGCGCAACCTGCGTTGGGAACGCCGCTACCGCCGCCTGCATTGGGCCGG
CTATGGCCTGATCGCCGCGCTGTTCGTCGCGCTGCTGGTGGGCTGGGTGGTCAGCTACCGCAGTAACAAG
GCTTATGTGGCCGAGGTATCGCGCCGCGTGCCCACGGTGGAAAAGCTGGGCCGCGATATCAAGATCACCC
AGGCGGGCGACGTGCTGGGCCTGATGCCGTTTCTGGACAGCCTCTGGTATTTGCCCCGCCACGCCAACTT
CGAACTGGATTCGCCGCCCCTGAACTACCAGTTCGGCCTGTACCAGGGCCAGAAGGTGCAGGCGGCCGCG
CAGGGCGTGTACCGCGGCACGCTGGAACAGGTGCTGGTGCCGCAGATCGCCCGGCGGGTAGAGACCGCGT
TGCGCAAGGCTGCCCCCGACGATCTGGAGTTCTCGTATGAGGCGCTGCGCGCCTACCTGATGCTCTACGA
GGCCGACCACTACGATGCCGAGTTCATGCATGCCTGGCTGCTGTCCGACATGCAGAAGACCCTGCCCGAG
GGCTACACGCGCCGCCAGTACGACCTGATGTCGCTGCACCTGCGCAATCTGGTGCAGGGCCGCGTGCTGT
CGTCGCCGTTCCCGCGCGACGACGAGCTGGTCAAGCAGGCGCGCGAGCGGCTGGCCCGCTACACGCTGGC
CCAGCGCGCCTACAGCCGCCTGCGCCGCATGCTGGCCAACACCGACCAGGGGCCGCAGCAGACCGCCATT
ACGCTGGGCGGGCCGCAGGCCAGCGCGGTGTTCGTGCGCAAGAGCGGCAAGCCGCTGACCGACGGAATCC
CGTCGCTGTACAGCTACAACGGCTACTGGAAAGTGTTCAACCAGCGCGTGACGCGGGTGGCCGACCTGCT
GCGCCAGGATGACGCGTGGGTGCTGAACATCGAGGCGCCGGGCATTCTGGACCAGCGCGCGCAGCAGCAG
TTGATCGTGGACATCAAGCGGCTGTACATGAACGACTACGTCGAACAGTGGGATGGCTACCTGAACGACC
TGCAGCTGGCGCCCACTACCTCGCTGCTGCAGAATATCCAGATGGCGCGCACTCTGTCCGCGCCAGAGTC
GCCGCTGGTGAAGCTGGTGCAGGGGGTGGCGCGAGAGACTTCGCTGCTGCGCGACACTGGCGACGGGCAG
TCGCTGATGGATCAGGCGCGCAACCGGGTCAGCAGCACGCGCGAGGCCCTGGAGCAGATGTTCGGTCCTA
CCGGTCCCAGCGCCGCGATGCGCGCCGATGCATCGGACGAAAAGCTGGAGCGCATCGTCGACCTGCATTT
CGAACCGTATCGCCGCCTGGCGCAAAGCGACGGCCAGGGCGCGCCGCCCGCCATCACCGCCACCACCGGT
CTGATCAATGAGCTGTACACCTACCTGACGGCGGCCGACGCGGCGCTGCGCAGCGCCAGCCCGGCGCCGG
GCTCGGACGTGGTCACCAAGCTGCGCGCCGAAGCGGGCCGCCTGCCCGAGCCGCTGCGCGACCTGCTCAA
TACGCTGTCGGTGAAGGCGTCGGGCGAAATCTCCGAGGCCACGCGCGAGCGCATGGGCGACACCGTGACG
GCGACCATTGGCGTGTTTTGCCGGCAGTCGATCGCGGGCCGCTATCCGTTCGCCAGCGGCTCGTCGCGCG
ATGTGGCGCCCAACGACATGGCGCGGCTGTTCGGGCCCAACGGCATGATGGATGATTTCTTCCAGAAGCA
CCTGGCCTCGCAGATCGACGTGTCCGGGTCGCGCTGGCGTTTCAAGCCGGGCATCGACGGCAAGCAGGGC
GACAAGGCGGCCTACCTGGATTCGTTCCAACGCGCCAGCGTCATCCGAGATGTGTATTTCACCGCGGGCA
ACCCGCTGCCTTCGTACCGCGTTGCGATCCGGCCGCTCGAAATGGATGCCCAGATCACGCAGTTCCTGAT
GGATGTGGACGGCCAGACGGTGCGCTACGCGCATGGGCCGCAGGTGGCCACTAATGTGCAATGGCCGGGG
CCGCGCGGCACCAACCAGGCGCGCATCGAGCTGACGCCGCAGGCCGGCCCGGCCGGGCTGTCGGCATCGG
GGCCGTGGGCCTTGAACCGCCTGCTGGACAAGGCGCAGCTGCGGCGCGGTTCGTCGCCCGAGGTGACGAT
TGCCACTTTCGACATCAATGGCCGCAAGGTGGTGCTGGAGATCACGGCCAGCAGCGTGAAAAGTCCTTTC
CATCTTGCCGAGATGCAGGGGTTCGCCTGCCCTGGCAAGTAA
 Primer design