SecReT6
Protein ID: 167033772
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2773
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3111368..3115165 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB0KU04
KEGG IDppg:PputGB1_2773
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.50E-61, Aligned region: 181..441
IcmF-related [PF06761], Evalue: 4.50E-44, Aligned region: 491..554
IcmF-related [PF06761], Evalue: 4.50E-44, Aligned region: 634..876
DUF1215 [PF06744], Evalue: 7.30E-23, Aligned region: 778..819
DUF1215 [PF06744], Evalue: 7.30E-23, Aligned region: 1009..1124
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 112..258
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 462..539
AAA_16 [PF13191], Evalue: 0.0002, Aligned region: 879..931
Protein Sequence: 1265 a.a.     [Download]
>gi|167033772|ref|YP_001669003.1| unnamed protein product [Pseudomonas putida GB-1]
MKTLLRLLKSFWVLLPLLWLASLLIGWLVAPLVPWLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVV
SLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTF
GLSEIRNSGLHAVLQTRLKNLQGHVRQHVDAQMIALGAEADSALLNFPQYFAALSDVLEQFLDHFTRGHR
GGTPLLLRGLYFTSALQTGQQLGQVYEDVIADEFALQAAYDEPAERAGKPVGNRSYFITDTFRQVIFPDR
DLTLYQSRLGRQATFSPLLLGLAVATGVLFIGWQALSFINNRQWLDGLRGQLAQIEHAQDREQLLAAGKG
LEVLRGQMAVVEAHRLQGVPLLLAAGLYHGEAVHQVSSAAYLAQLRSQALEPITRSLQVQMRAFNTFANG
INQELEFTPAPLPKKRNGKPLAPALAAKATAANTRLGGYAAKVNLATASDAAELSATTGGLSLSEEMLGR
LDEQQVASIIDAYNTLKMYLLLTEPQIHPDPAFVAASLPQAWTGAAAEGAPADAGVIEENAPLYVQLLEQ
GQAPALPRNEQLIDETRQNLKAFMISSSLVDREYLRLQLESSRQFPTLSLNDLVPQPGRALLYGSAGVPA
IYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDALVQKANFVREFMTRYKRDYTQAWYKMVSSVGV
RHFTDLASATEQLGLLSDVQNSPVKNLLAAVNDNTQWDLPTKHAIPAPGAARDDGFWSKVTGLFDTENAL
PTSVAPALPAVDDGSLAKRFEPVARVFAQNNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSKQL
ISETLEGQPSEVTTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWAALRDPAGQQIAKAWAQQIAKPWE
QVMAHRYPIAGGSNNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDSKGPALVNPGMLNSID
KASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSNAPGARLDVVT
LSGARVTVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSALN
DRGGQ
 
Nucleotide Sequence: 3798 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3111368-3115165 Pseudomonas putida GB-1 chromosome, complete genome
ATGAAAACATTACTGCGTCTGTTGAAGAGTTTCTGGGTGCTGCTGCCATTGCTGTGGCTGGCGAGCCTGT
TGATTGGCTGGCTGGTCGCGCCGCTGGTGCCGTGGCTGCGTCATCACGTACCTGAAGCGCTGGCCATCAT
CAGTGCCTGCTTCCTGCTGGTGATCGTGCTGCGCCAGTACCAGCGCATCCGCGCCGAGCACAACCTGGAG
AACCTGCTGCAAATCGAAGTCGACCGCTCGTGGAACGCCACGGGTGAGTTCCGAGACCAACAGGTATTGC
GCGAGCGCCTGAAGCACGCCATCGCCATGCTGCGCACCGATCGCTCAGCCGGTGGCGGCGGCAAGGCGGC
GCTGTCCGACCTGCCCTGGTACCTGGTGGTGGGCATGTCCGCTGCCGGCAAGACCTCGCTGCTGACCCAT
TCCGGTCTGTCGGCCAGCATCGCCACGGCCAACGACAGTGAAAGCGGTACCCAGCATTGTGACTGGTACT
TCAGCCCCGACGCCGTAATGATCGACACCGCCGGGCGCTACTTGCGCGACGACCAGTCAGCCAGTGAGTT
CTCGGCCTTCCTGCGCATGTTGCGCAAGCAACGCGGCAAGGCGGCGATCAATGGCTTGGTGCTGGTGGTC
AGCCTGCCCGAGCTGCTGGCGGCCAACAGCGATGAGCGCAATGCCCTGGCGGCGCAGCTGGTGGCACGGG
TAGAAGAATACGCCGAATGCCTCGACGCCAACCCGCCGGTCTACCTGATGCTGAGCAAGACCGACCAGTT
ACCGGGCTTCAGCCAGGCATTCGACGGCCTCGACCTGCATGAGCGCCAGCAACCGCTGGGCATGACCTTT
GGCCTGTCGGAAATCCGCAACAGTGGCCTGCACGCCGTGCTGCAGACGCGCCTGAAGAACTTGCAGGGTC
ACGTTCGCCAGCACGTCGATGCGCAGATGATCGCCCTCGGCGCCGAGGCCGACAGTGCGCTGTTGAACTT
CCCGCAGTACTTCGCCGCCCTCAGCGATGTACTCGAGCAATTCCTCGACCACTTCACGCGTGGCCATCGC
GGCGGGACCCCGCTGCTGCTGCGTGGCCTGTACTTCACCAGTGCGCTGCAGACCGGGCAGCAGCTGGGAC
AAGTCTATGAAGACGTCATCGCCGACGAGTTCGCCTTGCAAGCGGCCTACGATGAGCCTGCCGAACGTGC
TGGCAAGCCCGTGGGCAACCGCAGCTACTTCATCACCGACACCTTCCGCCAGGTGATATTCCCGGACCGC
GACCTGACCTTGTACCAGTCACGCCTGGGCCGGCAGGCCACGTTCAGCCCGCTGTTACTGGGCCTGGCCG
TTGCCACGGGTGTCCTGTTCATCGGCTGGCAGGCATTGTCGTTCATCAACAACCGGCAGTGGCTCGATGG
CTTGCGCGGGCAACTGGCGCAGATCGAACATGCGCAGGATCGCGAGCAACTGCTGGCCGCAGGCAAGGGC
CTGGAAGTGCTGCGCGGACAGATGGCGGTAGTCGAAGCCCATCGCCTGCAAGGCGTCCCCCTGCTGTTGG
CTGCTGGCCTTTACCACGGTGAAGCAGTCCATCAGGTGAGCAGTGCCGCATACCTGGCGCAATTGCGCAG
CCAGGCGCTTGAGCCGATCACCCGCAGCCTGCAAGTGCAGATGCGCGCGTTCAACACATTCGCCAACGGC
ATCAACCAGGAACTGGAGTTCACCCCAGCGCCGCTGCCTAAAAAACGCAACGGCAAGCCTCTCGCCCCTG
CCTTGGCCGCCAAGGCCACAGCAGCCAACACCCGCCTGGGTGGCTACGCCGCCAAGGTCAACCTGGCCAC
CGCCAGCGATGCCGCCGAGCTGTCCGCCACCACCGGTGGCCTGTCGTTGTCCGAAGAAATGCTCGGCCGA
CTTGACGAACAGCAGGTGGCCTCGATCATCGACGCCTACAACACGCTCAAGATGTACCTGCTGCTGACCG
AGCCCCAGATACATCCAGATCCGGCCTTCGTCGCTGCCAGCCTGCCCCAGGCCTGGACAGGTGCAGCCGC
TGAAGGGGCCCCGGCCGACGCCGGGGTAATCGAAGAAAACGCACCGCTTTACGTGCAGTTGCTGGAGCAA
GGCCAGGCGCCGGCACTGCCGCGCAACGAGCAACTTATCGACGAGACCCGGCAGAACCTCAAGGCATTCA
TGATCTCCAGCTCGCTGGTCGATCGTGAATACCTGCGCCTGCAACTTGAGTCGAGCCGCCAGTTCCCGAC
GTTGAGCCTCAACGACCTGGTGCCGCAACCGGGCCGTGCGCTGCTGTACGGGTCCGCTGGCGTGCCAGCA
ATCTACACGCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAACTGATCAAGCTGGTGTCGGGCAACCTGC
GCAACGAGTCGGACTGGGTGCTGGACGGTGAAGGCGGCGACGCGCTCGTGCAAAAAGCCAACTTCGTGCG
CGAGTTCATGACCCGCTACAAGCGCGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTCGGTGTG
CGCCACTTCACCGACCTGGCCTCGGCCACCGAGCAACTGGGCCTGCTCAGTGACGTGCAGAACTCGCCTG
TGAAAAACCTGCTGGCGGCGGTCAATGACAACACCCAGTGGGACCTGCCGACCAAGCACGCGATCCCGGC
CCCTGGCGCCGCCCGCGATGACGGTTTCTGGAGCAAGGTCACAGGCTTGTTCGACACCGAGAACGCCCTG
CCCACCAGCGTCGCCCCGGCCCTGCCGGCGGTGGACGATGGCAGCCTGGCCAAACGTTTCGAGCCGGTGG
CGCGAGTGTTTGCGCAAAACAACGCCGAAGGCGCCGACAGCACCATCATGGACCGCTACCTGGCCGCCTT
GCGCAAGCTCAAGGTACGCATGAACAACATCCAGCGTTCGCAGGATGTGGGCAAAAGCAGCAAGCAGCTG
ATCAGCGAAACCTTGGAAGGCCAGCCAAGCGAAGTCACCACCGTACGCAACTATGTGGAGAGCAGCGTCG
ACACCAGCCAGGACGGCTTGTCCCGCTCACTGCAGGGGCTGTTCAGCCTGCCCATCCAATACGCCTGGGC
GGCCCTGCGTGACCCGGCCGGCCAGCAGATCGCCAAGGCCTGGGCGCAACAGATTGCCAAACCGTGGGAA
CAGGTCATGGCGCACCGTTACCCGATTGCCGGCGGCAGCAACAATGAAGCGTCGGTGAAAGACCTGCAAC
GCTTCGTCGACCCGGACAGCGGCCTGCTGCCCGCCTTCAAACGTAACGAAATCGGCAACCTGGCCGGCGG
TGAGGGCCTGGGTGTGGGCGACAGCAAGGGGCCAGCGCTGGTCAACCCTGGCATGCTCAACAGCATCGAC
AAGGCCAGCTCGGTGGGCCAGGTGATTGCCAGCCTGTCTGACCGTGACAACGGCTTCGAGATCATGCTGG
AGCCGTCGGCCAACTTCACCGACATCGTGTTCACCCTCGACGGCCAGGAGCAGCACTACCGCAACGGCCG
TAGCAGCTGGAACCGCTTCGCCTGGCCGGGCACCAGCAACGCACCTGGCGCACGCCTGGACGTAGTGACC
CTGAGCGGTGCGCGGGTGACCGTGTTCGACTTCCCGGGGCGCTGGGGCTTGCTGCGTATGAACGAAAGCG
CCCGCGTAGACGACCTGGATGGCATTCAGCAACGCTTCAGCTGGAACACCGCCAGTGGTCGCGTGAGCCT
TGTGGTGCGCAACTTTGGCGGGGTCAAGCTGACCGACCTAGGTGACGTCAAGGCGCTGAGCGCCCTGAAC
GACAGGGGCGGCCAATGA
 Primer design