SecReT6
Protein ID: 167033774
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2775
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3116067..3118562 [+]
ProductOmpA/MotB domain-containing protein
NoteTssM
UniProt IDB0KU06
KEGG IDppg:PputGB1_2775
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.20E-67, Aligned region: 88..109
ImcF-related_N [PF14331], Evalue: 6.20E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 1.10E-16, Aligned region: 716..811
IcmF-related [PF06761], Evalue: 1.40E-08, Aligned region: 94..131
IcmF-related [PF06761], Evalue: 1.40E-08, Aligned region: 505..638
Protein Sequence: 831 a.a.     [Download]
>gi|167033774|ref|YP_001669005.1| unnamed protein product [Pseudomonas putida GB-1]
MNKIKYYCLRYQPYLLGVAFFLAIFLVWAIGRALGFASLHSLLAGIGAFLLLSAGYVLLLYRGAGQHHNL
EGLLRDDADQAVLSATPADREEVSLLRERLLQSIERLHSNKARGASAKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSAEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFGNAMDELASYWRQVAGQQLVHQDIQVTRQNNAAYRFPLELAALKPRLQQ
FVDSLLRANPYQNAELLRGFYFTAALQADEAQWGSHGQHVAERFALEQVEGSGTAGSQPAPLFINSLFRK
VIIPDQHLVALYTSNHRERRRKAGWVGAAGLAALVLCSLWGWSYLNNRATLASIAGELAQAKADDQAGSG
QYTAWRSLDRLRFWAAHYYQQHHEQGVPLGMRLGLYQGHAVEPLLRSRYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVSGVDSVEAEALPHDNRAQSIADFGKATLDTYVMLSQAMREKADPAFLKAHLP
DYWYPAIARHTGKRMAAAGSDASGDQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRSIETITLESDTLFAFGRADFQSLKNEGQNQLSAIASKLLNTPNIGKVVISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRAQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3116067-3118562 Pseudomonas putida GB-1 chromosome, complete genome
ATGAACAAGATCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGTGTGGCATTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCCGTGCATTGGGCTTTGCCTCGCTGCACAGCTTGCTGGCGGGTATCGG
TGCGTTTCTGCTGCTGTCGGCGGGCTATGTACTGTTGCTGTACCGCGGTGCTGGCCAGCACCACAACCTC
GAAGGCCTGCTGCGCGACGACGCCGACCAGGCCGTACTCAGCGCCACCCCGGCCGACCGGGAAGAGGTCA
GCCTGTTGCGCGAGCGCCTGCTGCAGAGCATCGAGCGCCTGCACAGCAACAAAGCGCGCGGCGCCTCGGC
CAAGGACGCGCTGTATGCCCTGCCCTGGTACCTGGTGATCGGCCAGCCGGCCGCGGGCAAGAGCACGATG
ATTCTGCAGTCGGGCCTGAACTTCCCCTACGCCGAGCGCGAAGGCGCACGGGTCGCAGGCCTGGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCCGAAGCGGTGCTGCTGGACACCGCCGGGCGCTACATGAACAG
CCCCGAAGAAGCCGGCAAGTGGCGTGGCTTCTTGCAACTGCTGCGCCAGCACCGCCAGCGCCGCCCGCTC
AACGGTTTGATCGTCAGCGTCAGCATCGCCGACATCCTGCATGGCTCGGCCGAGGACCAGGAGCGCGTGG
CCAAACGCCTGCGCGAACGCATCCAGGAAAGCTGCGCACTGCTCGAAGTGCGCCTGCCCATCTATCTGGT
CTTCACCAAGTGCGATCTGATCCCCGGTTTCACGCCGTTCTATCGCCAGCTGGACGACGCTGCGCGTGGT
GAAGTGATGGGCAAAACCTTCTCGCACAAGGGTTACGAGCAGGCCGACTGGGGCCAGCGCTTTGGCAACG
CGATGGACGAGCTGGCCAGTTACTGGCGACAGGTGGCTGGCCAACAACTGGTACACCAGGACATTCAGGT
CACTCGGCAGAACAACGCGGCCTATCGCTTCCCGCTGGAGCTGGCCGCGCTCAAGCCGCGCCTGCAGCAA
TTCGTCGACAGCCTGTTGCGTGCCAACCCCTACCAGAATGCAGAGTTGCTGCGCGGGTTCTATTTCACCG
CTGCGCTGCAAGCCGACGAGGCCCAGTGGGGCAGCCACGGCCAGCATGTGGCCGAACGCTTCGCACTCGA
GCAGGTTGAAGGTTCTGGCACTGCCGGCAGCCAGCCAGCCCCCCTGTTCATCAACAGCCTGTTCCGCAAG
GTCATCATTCCCGACCAGCACCTGGTGGCGCTGTACACCAGCAACCACCGCGAGCGCCGGCGCAAGGCCG
GGTGGGTTGGCGCCGCCGGCCTGGCAGCGCTGGTGCTCTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCACCCTAGCCAGCATTGCCGGCGAGCTGGCTCAGGCCAAGGCCGACGACCAGGCTGGCAGCGGC
CAGTACACCGCCTGGAGAAGCCTTGACCGCTTGCGCTTCTGGGCCGCGCACTACTATCAGCAACACCACG
AGCAGGGCGTGCCGCTTGGCATGCGCCTGGGCTTGTACCAGGGCCATGCGGTCGAGCCGCTGCTGCGCAG
CCGCTACTTCGCCACGCTGCAGAACGTGATGCTCAAGCCCACGGCCGATAACCTGACCCGTACCCTGTAC
CTGTTGACCACGCTCAAGGTCTACCAACGCAACACCCGCGAGCTGCAGCCGGTAAGCGGCGTCGACAGCG
TCGAGGCCGAGGCGCTGCCGCATGACAACCGCGCCCAGTCGATCGCCGACTTCGGCAAAGCGACCCTGGA
CACCTACGTGATGCTCTCGCAGGCAATGCGCGAGAAGGCTGACCCTGCGTTCCTCAAGGCGCACCTACCG
GACTACTGGTACCCGGCCATCGCCCGCCACACCGGCAAGCGCATGGCCGCAGCCGGTAGCGACGCCAGCG
GCGACCAGGACTACCTGTACGCCAGCCGCCAGATCACCTTCTACAGCGACCAGATCCGTGAGCCGGACGT
GCCACGCATCCTCGACAACGCCTTCCTGATGTCCAGCTCACGCAACTACATCGACAGCCTGCGGGCCCAG
TCGCTGCGCTCGATCGAGACCATCACGCTGGAATCCGACACCCTGTTCGCCTTTGGCCGCGCCGACTTCC
AGAGCCTGAAGAACGAAGGCCAGAACCAACTGAGCGCGATTGCCAGCAAGCTGTTGAACACCCCGAACAT
CGGCAAGGTGGTCATCTCTGGCCACGCCGATCAGCTCGGCGACAGCCAGGGCAACCTGCAGGTTTCGAAG
CAACGGGCGCAAACCATCCGCACCTACCTGGTCGGCAAGGGCGTGCCCGCCGAGCTGGTGGTCGCGCAAG
GCGAAGGCAGCCGCAAACCACTGGTCAACTGCGACATGCAACAACCGCGGGCGCAATTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTGCGTGGGCTGAACTGA
 Primer design