SecReT6
Protein ID: 167034218
SecReT6 ID253
T6SS typei1
Gene symbol-
Locus tagPputGB1_3221
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3606556..3610140 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB0KHN1
KEGG IDppg:PputGB1_3221
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-84, Aligned region: 521..826
ImcF-related_N [PF14331], Evalue: 2.40E-68, Aligned region: 214..473
DUF1215 [PF06744], Evalue: 2.00E-28, Aligned region: 923..1044
Protein Sequence: 1194 a.a.     [Download]
>gi|167034218|ref|YP_001669449.1| unnamed protein product [Pseudomonas putida GB-1]
MNQIWNPFKRWGLQWVTRAGLALPLLLGLGTALMLVAIWWLGPQWSWYEQKPLASVLHRSLASLVFLLML
LLGCLVVLRIRYRRLQAERREVVAAEQDRALHFVQAQEMALSQGLDRYLDNAGGRRALYRLPWYLVLGDE
QSGKTSFVDRSDQRFTLTRIDQAQARGRQAEALAYPVGWWVSDDAVIIDPPGIFISQNPPAGSAATDPSA
PPGTQARLWEHLLGWLLRNRSRRALNGLLLVVDLPALLHGKPEQRAALAHGLRTRLYEVSSQLGSRLPLY
VVLTKFDLLDGFDQLYSKLSAAKRESLLGFTFKLDAVDTFDAWLEEYDQQYGRLLAKLNEQVFDRLDVLG
KTAPRGQLFSLHAQLIGLRPILLTFLRETLASDRFTTPALVRGVYWSSVVQQGDIRNVFVREAAQPYKTK
LPLLEGKAQGKALAYFIQQAFRRVIYQEAGLAGDNIRVTRSKRQLLWVGSGVGILAFSVAIGSWQRYFDI
NSSKATSVLAKSQEYSQREVDQRLDPTGRNLLEPLDRIRDAVAVFGDYRTAWPGVADFGLYEGRNIGPLV
DEAYLSLLSKRFLPALAGGVIDVMNAATPGSERQMAALRVYRMIEERHSRRPEWVEDWMARQWQQAFPGQ
GQLQRDLMQHLKYALAYADADLPQYRQRVNEVQQALRELPLPLRVYTGLKQQAHEQLHTSLDLRHQVGPA
FDVVYQTSSGAQGEDVTLAPMLTAKGFREYFAPRSERFAEMAMVDQWALGERSQLDYSDIDRHALTERLH
NLYSADYIDSWRRALNAFTVADFRDLDHGVTILEQLTGPAAPLQRLLETVRDNTSLASPAVVETPSEVTK
LRPPTAKPDQQQTLAIPRAFAGLGAMLQATGEKPTYYDETLGAIAAVLNYAKAVQDSPDRGKAALQAVHQ
RFSMTGQDPIGTLQRIATGLPEPINHQVRKLADQTAQVLNVEALRELERRWDAEVYSFFQQRLANRYPFV
VRAPDAALDDFEAFFGPKGRLQQFNERYLKVFLKENLEALYSSQYGQSLIREDVIEQLELADRIRETFFD
QRGKLSVQFSIEPLGLSANQRTSLLDLDGQLISYTHGPRQITGIVWPNTLGQQVRSNLTLLRQSGNSSSL
EYRGPWSMFRLLSRGSLNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQQPLKV
AQME
 
Nucleotide Sequence: 3585 bp     [Download]
>gi|167031021|ref|NC_010322.1|:c3610140-3606556 Pseudomonas putida GB-1 chromosome, complete genome
ATGAATCAAATATGGAACCCATTCAAACGCTGGGGGCTGCAGTGGGTAACGCGCGCGGGCTTGGCGCTGC
CGCTGTTGCTCGGGTTGGGCACCGCACTGATGCTGGTCGCCATCTGGTGGCTCGGACCGCAATGGTCGTG
GTATGAACAAAAGCCACTGGCGAGTGTGCTGCATCGCAGCTTGGCAAGCCTTGTTTTCCTGCTGATGCTA
CTTCTAGGCTGTCTTGTAGTACTGCGCATACGCTATCGTCGCCTGCAAGCGGAACGTCGGGAGGTAGTGG
CCGCCGAACAAGACCGGGCGCTACATTTTGTGCAGGCGCAAGAGATGGCGCTGAGCCAAGGGCTTGACCG
GTACCTTGACAATGCGGGTGGGCGACGTGCGTTGTACCGGCTGCCCTGGTACCTGGTGTTGGGTGACGAA
CAGTCCGGTAAAACCAGCTTTGTCGACCGCAGCGATCAACGCTTTACCTTGACGCGCATCGACCAGGCTC
AGGCACGAGGCCGACAGGCTGAAGCATTGGCCTATCCGGTGGGCTGGTGGGTCAGCGACGATGCTGTAAT
CATTGACCCGCCCGGTATTTTTATCAGCCAGAATCCACCAGCGGGCTCGGCGGCCACCGATCCCTCCGCG
CCGCCTGGCACCCAGGCCAGGTTGTGGGAGCATCTATTGGGTTGGCTGCTGCGCAACAGAAGCCGGCGGG
CGCTCAATGGTTTGCTGCTGGTTGTCGATCTACCGGCACTGCTGCATGGCAAGCCAGAGCAACGCGCCGC
CCTGGCCCATGGCTTACGCACACGCCTTTACGAAGTGAGCAGTCAGCTGGGATCGCGCTTGCCACTATAC
GTGGTGCTGACCAAATTCGATCTGCTGGATGGCTTCGATCAGTTATACAGCAAACTTTCGGCCGCCAAGC
GTGAAAGCCTGTTGGGGTTCACTTTCAAGTTGGATGCGGTCGATACGTTCGACGCCTGGCTGGAAGAGTA
CGACCAGCAATACGGTCGGCTGCTCGCCAAGTTGAATGAACAGGTCTTTGATCGGCTGGATGTGCTGGGC
AAGACAGCACCGCGCGGGCAGCTGTTCTCACTGCATGCACAGCTGATCGGTTTGCGTCCGATACTGCTGA
CCTTTCTGCGTGAAACGTTGGCGAGTGACCGTTTCACCACGCCTGCGCTGGTACGAGGTGTGTACTGGTC
GTCAGTGGTGCAGCAAGGCGACATCCGCAATGTGTTCGTTCGCGAAGCAGCACAGCCGTACAAGACTAAA
CTTCCGCTGCTTGAAGGCAAGGCTCAGGGCAAGGCGTTGGCTTATTTCATCCAGCAAGCCTTCAGGCGAG
TTATCTATCAAGAGGCCGGTCTGGCAGGCGACAACATCCGGGTGACGCGCAGCAAGCGGCAGTTGCTGTG
GGTTGGCTCGGGTGTAGGCATCCTGGCGTTCAGTGTCGCCATCGGCAGCTGGCAACGCTACTTCGATATC
AATAGTTCCAAGGCTACCAGCGTGCTTGCCAAGAGCCAGGAATACAGCCAGCGCGAAGTGGATCAGCGTC
TTGATCCGACCGGGCGCAACTTGTTGGAGCCTCTGGATCGGATCCGCGATGCGGTGGCGGTATTCGGTGA
CTATCGCACGGCGTGGCCGGGTGTTGCCGACTTTGGCCTGTATGAGGGGCGCAACATCGGTCCTCTGGTT
GACGAGGCGTACCTGAGCTTGCTGTCCAAGCGCTTTTTGCCTGCATTGGCCGGCGGCGTGATTGACGTCA
TGAACGCAGCAACACCGGGTAGCGAACGACAAATGGCTGCGCTTAGGGTTTACCGTATGATCGAAGAGCG
CCATAGCCGCAGGCCTGAATGGGTCGAAGACTGGATGGCACGTCAGTGGCAACAGGCTTTCCCTGGCCAA
GGGCAGTTGCAGCGTGACCTCATGCAGCATCTGAAGTACGCCTTGGCTTATGCCGATGCCGATTTGCCGC
AATACCGGCAGCGCGTCAACGAAGTACAGCAGGCGTTGCGTGAGCTACCTCTGCCACTGCGGGTTTACAC
GGGACTGAAGCAACAGGCGCACGAGCAACTGCACACCAGCCTGGACCTGCGTCACCAGGTGGGCCCCGCA
TTCGACGTTGTTTACCAGACATCTTCCGGTGCCCAGGGGGAGGATGTAACGCTGGCCCCTATGCTGACTG
CCAAAGGTTTCAGAGAGTACTTTGCGCCGCGCAGCGAGCGATTCGCTGAGATGGCGATGGTCGATCAGTG
GGCATTGGGGGAGCGCAGCCAACTCGACTATTCGGACATTGACAGGCATGCGCTTACCGAAAGGTTGCAC
AACCTCTACAGCGCCGATTACATCGACAGTTGGCGTCGCGCCTTGAATGCATTCACCGTGGCTGACTTCC
GTGATCTGGATCATGGTGTCACGATTCTGGAGCAATTGACCGGCCCCGCAGCCCCTTTGCAGCGGCTGCT
GGAAACAGTCAGAGATAACACTTCGCTTGCTTCACCTGCGGTGGTTGAAACACCGAGCGAAGTGACCAAG
CTGCGACCACCAACAGCCAAGCCTGATCAACAGCAAACCTTGGCCATTCCGCGGGCGTTTGCAGGGTTGG
GCGCCATGTTGCAGGCAACAGGAGAAAAACCGACCTACTACGATGAAACCCTTGGTGCGATAGCGGCCGT
GCTGAACTACGCCAAGGCCGTTCAGGACAGCCCGGATCGTGGCAAGGCCGCACTGCAAGCCGTGCATCAA
CGCTTTTCGATGACAGGGCAGGACCCGATCGGCACCCTGCAACGTATTGCCACAGGCTTGCCGGAGCCAA
TCAACCACCAGGTTAGAAAGCTTGCCGATCAGACTGCCCAAGTGCTGAATGTTGAAGCATTGCGCGAACT
GGAGCGACGCTGGGATGCTGAAGTGTACAGTTTCTTCCAGCAACGCCTGGCAAACCGCTACCCCTTTGTG
GTGAGGGCGCCCGATGCTGCGCTGGATGACTTCGAGGCGTTCTTCGGGCCGAAGGGGCGCCTGCAGCAGT
TTAATGAACGCTATCTCAAGGTCTTCCTGAAGGAAAACCTCGAGGCCTTGTATTCTAGCCAGTACGGGCA
ATCCTTGATCCGTGAGGATGTGATCGAGCAGCTCGAGTTGGCGGATCGCATTCGTGAAACGTTCTTCGAT
CAGCGTGGAAAGCTGAGTGTGCAATTCAGCATCGAGCCGTTGGGTCTCAGCGCGAACCAACGTACCAGCC
TGCTGGACCTGGATGGCCAGTTGATCTCCTATACCCATGGGCCACGCCAGATCACCGGTATCGTCTGGCC
AAATACCTTGGGGCAGCAGGTGCGCAGCAACCTGACCCTGCTCAGGCAGAGCGGCAATAGCAGCAGCCTT
GAGTACCGTGGCCCATGGTCGATGTTCCGTTTGCTCAGCCGCGGTTCGCTGAATGGGCGCACGGCAACCA
GCGTGGACCTGAGCTTCAGGACGGGTGACGGTGTGATGCGCTATCGGTTGAATGCTGAAAAGGCCTTCAA
TCCCATTACCCAGCAGCCGTTCAAGGGCTTCCGTTTACCGCGAGGGTTGTTGCAACAGCCACTCAAGGTT
GCTCAGATGGAGTAA
 Primer design