SecReT6
Protein ID: 16763656
SecReT6 ID23
T6SS typei3
Gene symbol-
Locus tagSTM0274
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconchromosome [GenBank: NC_003197] [Browse all T6SS(s) in this replicon]
Location [Strand]314499..316007 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ8ZRL7
KEGG IDstm:STM0274
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-191, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|16763656|ref|NP_459271.1| hypothetical protein STM0274 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITVSDDAYKSISA
IIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWD
QSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQE
LANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYV
WSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRL
VTKLPSVKQGNA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|16763390|ref|NC_003197.1|:314499-316007 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGCAACAGGCGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCT
ATTATTGCGCAGATCGACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGA
AGCTGGAATCCTCGTGGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAAT
TCGCTTCATGAATCTGTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGAT
CAAAGCCCGATGTTCAAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTA
TCATTGCGGATTACTACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGC
CGCGTCGGCCCATGCGCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAA
CTGGCGAATCCCCGCGACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGC
GGGCTAGCGAAGACTCCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGC
AAAAACCAACCCGGTGGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTC
TGGAGCAACGCGGCCTACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGT
TGATTCGCGGTGTGGAATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGG
CGGCGTGGACATGAAATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAAC
GGTTTTATCCCGTTGATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAA
AACCACAGGAATACTACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTT
CGCCTGCTCGCGCTTCGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGT
GAGGATATGCAGCGCTGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGC
AAGAAACTAAAGCCCGTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGG
TTATTACGACGCGAAATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTG
GTGACAAAACTGCCGTCAGTGAAGCAGGGCAATGCCTGA
 Primer design