SecReT6
Protein ID: 16763659
SecReT6 ID23
T6SS typei3
Gene symbol-
Locus tagSTM0276
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconchromosome [GenBank: NC_003197] [Browse all T6SS(s) in this replicon]
Location [Strand]316893..317378 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ7CR58
KEGG IDstm:STM0276
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|16763659|ref|NP_459274.1| hypothetical protein STM0276 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|16763390|ref|NC_003197.1|:316893-317378 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTGGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA
 Primer design