SecReT6
Protein ID: 16763674
SecReT6 ID23
T6SS typei3
Gene symbol-
Locus tagSTM0291
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconchromosome [GenBank: NC_003197] [Browse all T6SS(s) in this replicon]
Location [Strand]332551..336645 [+]
ProductRHS-like protein
NotePAAR
UniProt IDQ8ZRL0
KEGG IDstm:STM0291
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 390..425
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 410..445
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 474..492
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 518..555
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 582..619
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 624..660
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 666..696
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 708..744
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 751..785
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 797..826
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 842..863
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 848..883
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 889..920
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 981..998
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 989..1017
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1032..1051
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1056..1089
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1119..1126
RHS_repeat [PF05593], Evalue: 6.30E-47, Aligned region: 1143..1165
PAAR_motif [PF05488], Evalue: 2.60E-15, Aligned region: 71..140
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 549..566
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 576..594
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 866..884
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1040..1050
RHS [PF03527], Evalue: 4.70E-08, Aligned region: 1145..1177
Protein Sequence: 1364 a.a.     [Download]
>gi|16763674|ref|NP_459289.1| RHS-like protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
IHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVIED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELV
GMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRDD
DEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTGVV
NRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGAPRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQG
ETWQWWYDRETYITAHRTPGGGMYRFTYNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQW
NGEFDEITRTALDDDAVWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRGQM
TRYTDCSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMSSHRRIT
GSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVAALTNGNGAQYRFSHDADGRLVREVRPDGLSRTFI
LDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHGQRTFSYNRLDQITAVTLTPTEAGQQQHRMQ
ADTVRFEYDRSGWLTAEHAGNGSICYQRDALGNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYER
DSLHRQIMRTQGQLATYSGYDDDGLLSWQRSLASGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDG
LRGSVVYSYDRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGAVMSNRLPGCGRDRYGYNEWGELTTRR
DQQLEWNAQGQLTRVISGNTETHYGYDALGRRTRKATYGRHTGHTARSRTDFVWEGFRLLQENVQQQGWR
TYLYDAEQPYTPVASVTGRGESRQVWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFH
QPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQDPIGLRGGLNLYQYAPNPLKYIDPLGLTATVGRWMG
PAEYQQMLDTGTVVQSSTGTTHVAYPADIDAFGKQAKNGAMYVEFDVPEKSLVPTNEGWAKIVGPDSIEG
RLAKRKGLPVPEMPTAENITVRGEKINGEVEAKC
 
Nucleotide Sequence: 4095 bp     [Download]
>gi|16763390|ref|NC_003197.1|:332551-336645 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
ATGTATGAAGCAGCCCGTGTGGATGATCCTATCTACCACACCAGCGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
ATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAAGGGTCGGAAAA
TATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTGTC
GGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGCGATGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGACGCCCG
GCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGTCAGTTTGCTTATGAAAACGGGCTGATGACGGCGCACAGCAATGCGA
CGGGGTTCACCTGCCGCTACCGCTGGCAGGAACTCGACGGCGCGCCGCGCGTGACGGAGCACGACACCAG
TGACGGCGAACATTACCGCTTTGACTATGATTTTGCCGCAGGCACCACCACCGTCACCGGCAGGCAGGGG
GAGACATGGCAGTGGTGGTACGACAGGGAAACGTATATCACCGCGCACCGGACGCCGGGCGGTGGAATGT
ACCGCTTCACGTACAACGAAGACCACTTCCCTGTCAACATTGAGCTGCCCGGCGGTCGCACGGTGGCGTA
TGAATATGACATCCAGAACCGGGTGGTGAAGACGACAGATCCGGAAGGCCGGGTGACGCAGACGCAGTGG
AACGGCGAGTTCGACGAAATCACGCGCACGGCGCTGGACGATGACGCTGTCTGGAAAACGCAGTACAACG
CCCACGGCCAGCCAGTGCAGGAGACGGACCCGGAAGGGCGGGTGACGCAGTACGCTTACGATGAACAGGG
GCAGATGTGCAGCCGGACGGATGCGGCGGGCGGCACGGTGGTGACGGCGTTCGACAGCCGGGGGCAGATG
ACGCGGTACACCGACTGTTCAGGGCGCAGCACAGGATATGACCACGATGAGGACGGCAACCTGACGCGGG
TGACGGACGCGGAAGGGAAGGTGGTACGCATCAGCTACAACCGACTTGGGTTGCCGGAGACGGTAAACTC
ACCGGGGAAACAGCAGGACAGGTATACCTGGAATGCGCTGGGGCTGATGAGCAGCCACCGGCGCATCACG
GGGAGCGTGGAGAGCTGGCGGTATACGCCGCGCGGTCTGCTGGCGGCGCACACGGATGAGGAGAAGCGCG
AGACGCGCTGGCAGTACACGCCGGAAGGCCGGGTGGCAGCGCTGACCAACGGCAACGGGGCGCAGTACCG
GTTCAGTCACGATGCGGACGGCAGGCTGGTGCGTGAGGTTCGCCCGGACGGACTGAGCCGTACTTTTATC
CTGGACGACAGCGGTTATCTGACGGCGATACAGACCACGGGCACGCAGGGCGGCGTGCGGCGGGAGACGC
AGCAGCGGGATGCGCTGGGCCGTCTGTTACGGACGGAGAATGAACACGGCCAGCGGACGTTCAGCTACAA
CCGGCTGGACCAGATAACGGCAGTGACGCTCACGCCCACGGAGGCGGGGCAACAGCAGCACCGGATGCAG
GCCGACACGGTGCGTTTTGAGTATGACCGCAGCGGCTGGCTGACGGCGGAGCACGCGGGGAACGGTAGCA
TATGTTATCAGCGCGACGCGCTGGGCAACCCGACGGACATCACGCTGCCGGACGGGCAGCACCTGACGCA
TCTGTATTACGGGAGCGGGCATCTGTTACAGACGGCGCTGGACGGCCTGACGGTGAGCGAGTATGAGCGC
GACAGCCTGCACCGTCAGATAATGCGCACGCAGGGGCAGCTTGCGACGTACAGCGGCTATGACGACGACG
GGCTGCTGAGCTGGCAGCGCAGTCTGGCGTCCGGCAGTGCCCCTGTTCTTCCTGGCCAGCGCCCGGCGCG
GCAGGGCTGCGTGACGTCGAGGGACTATTACTGGAACAACCACGGCGAGGTGGGCACGATTGACGACGGC
CTGCGTGGCAGCGTGGTGTACAGCTATGACAGAAGCGGTTACCTGACCGGGCGCTCAGGTCAGATGTATG
ACCATGACCGTTATTATTACGATAAGGCGGGCAACCTGCTGGATAACGAAGGGCAGGGAGCGGTGATGAG
CAACCGGCTGCCGGGCTGTGGTCGTGACCGTTACGGCTATAACGAGTGGGGCGAGCTGACCACGCGGCGC
GACCAGCAACTGGAGTGGAACGCGCAGGGGCAGCTGACGCGGGTCATCAGCGGCAACACGGAGACGCACT
ACGGCTACGATGCGCTGGGGAGGCGAACCCGCAAGGCGACGTACGGGCGGCACACGGGCCATACGGCGCG
GAGCCGGACGGACTTTGTGTGGGAGGGGTTCAGGCTGTTGCAGGAGAACGTGCAGCAGCAGGGCTGGCGG
ACCTATCTGTACGATGCGGAACAGCCGTACACGCCGGTGGCGAGCGTGACGGGGCGGGGAGAAAGCAGGC
AGGTGTGGTATTACCACACGGATGTGACGGGCACGCCGCAGGAGGTGACGGCGGCGGACGGAACGCTGGT
GTGGGCGGGGTATATCAGGGGGTTTGGAGAGAATGCGGCGGACATCAGCAACAGCGGGGCGTACTTTCAC
CAGCCGCTGCGGCTGCCGGGGCAGTATTTTGACGACGAGACAGGGCTGCATTACAATCTGTTCAGATATT
ATGCACCGGAGTGTGGACGGTTTGTCAGTCAGGATCCGATCGGGCTGAGGGGCGGGTTAAACCTTTATCA
GTATGCGCCAAATCCTCTCAAATATATAGACCCACTTGGTTTAACCGCGACTGTTGGGCGATGGATGGGG
CCTGCGGAATATCAGCAAATGCTTGATACTGGGACAGTAGTACAAAGTTCAACAGGGACAACTCATGTTG
CCTACCCTGCTGATATAGATGCTTTTGGTAAGCAAGCAAAAAATGGTGCTATGTATGTTGAATTTGATGT
GCCTGAAAAATCATTAGTACCTACAAATGAAGGATGGGCAAAAATAGTAGGGCCAGATTCTATCGAAGGG
CGATTAGCTAAACGCAAAGGTTTGCCTGTTCCTGAAATGCCAACAGCAGAAAACATAACTGTAAGGGGCG
AGAAAATTAATGGGGAAGTTGAAGCAAAATGCTAA
 Primer design