SecReT6
Protein ID: 169633793
SecReT6 ID254
T6SS typei4b
Gene symbol-
Locus tagABSDF2244
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2069874..2073698 [-]
Producthypothetical protein
NoteTssM
UniProt IDB0VRP9
KEGG IDabm:ABSDF2244
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.70E-70, Aligned region: 188..451
IcmF-related [PF06761], Evalue: 2.00E-52, Aligned region: 462..483
IcmF-related [PF06761], Evalue: 2.00E-52, Aligned region: 496..837
DUF1215 [PF06744], Evalue: 4.20E-25, Aligned region: 774..798
DUF1215 [PF06744], Evalue: 4.20E-25, Aligned region: 968..1080
Protein Sequence: 1274 a.a.     [Download]
>gi|169633793|ref|YP_001707529.1| hypothetical protein ABSDF2244 [Acinetobacter baumannii SDF]
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALAFAYALGLIVYGIYWLIQRKKHAVQGEE
LAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAI
YNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPV
HGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYN
QAWGATLPYEQNSSHNAVDLFEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKTALKSFI
ATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNKVVQLEKSSGQ
QLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLIPTQQNIAQYLQR
VKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNALKAYLMMSNPQYLDASHLSDQVTRFWRSWL
DANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRA
AVRFPALTVSQIVGDANKNIVLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFS
GSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMT
NLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQ
AFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFV
IRRGYTLTSKTWKDLGISLNPQFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSY
TVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGG
FEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTEN
PVSALAQPAAGVKP
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2073698-2069874 Acinetobacter baumannii SDF chromosome, complete genome
ATGCATACAATTTTAGGCTACTTGTGGCAGTACATCACGAATCCTAAAGCAATTATCGCCTTGTCATTGT
TCGTGGCATTGATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGCTTTAGCATTTGCATATGC
TTTAGGGCTCATCGTTTATGGAATTTATTGGCTAATTCAGCGTAAAAAGCATGCTGTCCAAGGTGAAGAA
CTTGCGCAAGCGATTGAAAAGGATACACAAGCAGAGTACGGCAAAAATAAAGATAAAGAAGAGCTGCAAC
TTATTAGCCAACAAATGAAAGAATCTATTCAATTGATTCGTAAGTCAAAGCTAGGCGATAAAAAGGGGAA
CGCAGCACTATATGAGTTGCCATGGTATATGGTCATTGGTAATCCGGCTGCTGGTAAAAGTTCTGCGATC
TATAATTCTGGTTTAAAGTTTCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTTTAAGCGGTA
CGCGTAATTGTGACTGGTTTTTTTCGACTGAGGGTATTTTACTCGACACTGCTGGACGTTATTCGGTCTA
TAGTGAAGATCACTCTGAATGGTTAGGCTTTTTAAATATCTTAAAGAAGAACCGTTCTAAGGCTCCAGTA
CATGGTTTAATTCTTATTGTTAGTATTGCTGAGCTTGTTAGCCAGAGTCCTGAACACTCATTAAAGCTTG
CGAAAAATTTACGCGCTCGTATTCAGGATTTAACCGAACGTTTAGAAGTGGTTGTACCTGTATATCTAGT
CTTTTCAAAAATGGATTTGATCGCGGGTTTTACCGAATTTTTCGAATTCTATGAAGCACAAGAATATAAT
CAGGCGTGGGGCGCAACACTACCATATGAGCAAAACTCTTCTCATAATGCTGTAGATCTTTTTGAGAAAC
ACTACAATATTCTTTATGACGGTTTAAAAGGGGTCAGTTCAACTCATCTTAGCCGTCGACATTCTCAAAA
TATCTCACCTAGTGTGATGACTTTCCCATTAGAATTTAAGACATTAAAAACTGCATTAAAAAGTTTTATT
GCGACACTGTTTGAAGATAACCCTTACCAGTTCCAACCAGTTTTCCGTGGGTTTTATTTCACAAGTGCTT
TGCAAGAAGGCGTAATAGAAAGTCCAATGACTGAGCAAATTGCACAGGAATTCCAGCTTTCCCAAATTGC
TCAAAGTGAAGTAAAAGATCAGCTAAAAACAACGCCTAACCATGGTTATTTCTTAAAAGGCTTGTTTTCA
GATGTCATTTTAAAAGATAAAGATCTGGTTAAACAGCATGTCAATACAAGCAAAAAGCGTCAGCGTTATA
TTGCATTTATTGGTGCTTTAGCTGGCGTATCCATTATTCTGGGTGTGTGGGTTTGGTCATATCGTAACAA
TCAACAACTTATTGCCGAAGTTCAAGCTGATTTGAATAAAGTTGTTCAATTGGAAAAGAGTTCAGGTCAA
CAATTGTCGACTCAATTAGAGGCCTTACTTATCTTGCAAAGACGTCTACAACAGTTAGACGAATTTGATG
AAAATAGACCACTAAAATTTAGTTTTGGTTTATATCAAGGTAATGAGCTACGTGAAAAATTAAAAGCTGA
ATATTTAAAAGGTGTTAAGCAAATTGTTTTGATACCTACACAGCAAAATATTGCTCAGTATTTGCAACGT
GTAAAAAATAACGAAGCAACTTTAAAAGCAAATCATACCAATGTTGAGATCAAGCAAACTGCCCAAACTC
AGCAATATTTAGAGCCTTCGGATACCAACCCTCAAGATGCTTATAATGCTTTAAAAGCATATTTAATGAT
GAGCAATCCACAGTATTTGGATGCAAGTCACTTAAGTGATCAGGTAACGCGTTTCTGGCGTTCTTGGCTT
GATGCCAATAAAGGGCAGATGCCACGTGCAGATATGATCCAAGAAGCTGAGCAGATCTTATCTTATGCAA
TGACATTGGCAAATGATAAACAATTCCCGATCTTGGATGCTGACTCTCAACTCGTGGATCAGACACGTCA
AGTATTGCTCTCTGTTATTAGAGGTATGCCAGCACGTGACCGTGTTTATAATGAAATTAAAATGCGTGCT
GCTGTGCGCTTCCCAGCTTTAACTGTAAGCCAGATTGTAGGTGACGCAAATAAAAATATTGTATTGGGTA
GTTATGCATTACCAGGGGTATTTACTCAAAAAGCTTGGAATGAGTATGTAGAAAAAGCAATTGAGGAAGC
AGCAGACAAACCTACGGATACTAAAGACTGGGTGCTTAATAGCCGTCAATCTGATGATTTAACTTTCTCT
GGTAGTCCAGAGCAAATCAGAAAGCAGCTTACTGCATTGTATAAACAAGAATATATTGCAGAGTGGAGAA
AATTCTTAAGTGGTATTCACTATGCAAAAGCAACTCAGTTTGCTCAGCAAGTTAAAAATATTGATGTATT
GGGTGAACCACAAAATTCACCAATTCGCACACTTATTGAACGCGTAGCTATTGAAACAAATTGGGATAAT
CCGGTCGTTCAAGCCGAGTTAGCAGCACCTCAAAAAGGATTTATTGCATGGTTTAAACGTAAGGTTTTAA
ATCATGATGATAAACAATTAGCAAATCAGGCTGTAACGAATGCTCAAGGGCCTATTTCTCAAGAATATCA
AATGTTCTATCAATTGGTTCGTAAACGTGATGATCAGCAAGGTAAATCTTTGCTTGATGAATATATGACG
AATCTTGCCTTAGTACGTAGTAAGTTTAATGAACTTAAGAATGCGGGTGAGATTGGACCGAATGCGATGA
CATTGGTTAAGCAAACTTTAAATGAGCAGACATCGGTATTTAACCAGACTCAAAAAATTGTAGATGAAAA
GATGGCGGTTGGTTTCAGTGAAATTGATCAGCAACTTCTACAAAAATTAGTGGTGAGTCCACTTACCCAA
GCCTTTGAAAGTTTAATTACACCTACTCAAGATGAAATTAATAAGCTATGGGTAATGCAAGCCTATCAAC
CATTTACTGCAAATCTTGCTAAGAAATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGA
AATTGGACAAATTCTTGGTGAAAACGGCAGTATTTCCCGTTTTGTTAAAGAGAGTTTAGATCCGTTTGTT
ATCCGCCGTGGTTATACTTTAACTTCAAAAACATGGAAAGATTTGGGGATTAGTTTAAACCCACAATTTG
TTATGAACTTCCAACGCTATGTTGCACCTACAAATGGAATGGCAACAGGTGAGTTAAATAGCCAAGCACC
AGCTGCTCCGGCAACCAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAATTACTTTCATAT
ACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAATGGGGTGCAGCAATGGGTTAACTTTATTTGGC
CAAATCAAGGCAGTATTCCGGGTGCTCGTATTACAGCTGTAGATTTACAAGGTCAAACACATACCATTTT
TGATGAACCAGGCGAATACGGGATTAACCGTTTAATCGATAGTGCACAGCGTAAAGAGCAAAACGGTGGT
TTTGAAATGCTTTGGCGCAGTAAGACAGATCCATCACTCTTTGTGAAAATGAACTTCCGTCTTATTAGTA
GTAATTCAGGAAGTATCGGTTCAAGCCGTGGCTACTCTGGTATGCAACTGGTTGACAAAGTAACTGCGGA
TAAGGCTGCTCGCGTTGTATCCGCACAGCAAGCACCAGCTCAGGCAGCTGCTCCTGCCAAAACTGAAAAT
CCAGTTTCTGCACTAGCACAACCTGCTGCGGGAGTTAAGCCATGA
 Primer design