SecReT6
Protein ID: 170022640
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0387
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]420199..421680 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1JJP1
KEGG IDypy:YPK_0387
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-185, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|170022640|ref|YP_001719145.1| EvpB family type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVAAFISSILDTGTNEEPINKLLVDRMI
IELDKKLSAQMDEILHANEFREIESSWRSLKLLVDRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGF
YKHVYSSGYGQFGGEPTAAIIGNYAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAI
KDLKSVFEGPAHTKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAF
LLASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFELAEEGFITLTM
RKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDL
ERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRL
DKE
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|170022262|ref|NC_010465.1|:420199-421680 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCCTTTACATGAAGAAAATACCGTTTTAGCGGCAGAACCTGCCAGTGCAACATTCTTGCTCGACGAAA
TCATGTCACAAACCCGTATGGCACCGGGAAACGATGGTTACGATATCGCTAAACAGGGTGTGGCCGCTTT
TATTAGCAGTATTCTGGATACCGGAACCAACGAAGAGCCGATTAACAAGCTGTTAGTTGACCGCATGATC
ATCGAACTCGACAAAAAGTTGAGTGCTCAGATGGACGAGATCCTACATGCTAACGAATTCCGTGAAATAG
AATCTTCATGGCGCTCATTGAAGCTGTTGGTGGATCGGACCGATTTCCGTGAAAACATCAAAATCAATAT
CATGCATGCAACGAAAGAAGAGTTGCTGGAAGATTTTGAGTTCTCGCCAGAAATTATTCAGTCAGGCTTC
TACAAACACGTTTATTCCTCAGGGTACGGCCAATTCGGTGGTGAACCCACTGCCGCGATCATTGGTAACT
ACGCGTTCAACAATAGCTCACCTGACATGAAGCTCTTGCAATACGTAAGTGCTGTTGGCGCGATGGCACA
TGCCCCCTTCTTATCCAGTGTGGCCCCTGATTTCTTTGGCATCAGCAGCTTCACTGAGTTACCCGCGATT
AAAGATCTGAAATCTGTATTTGAAGGGCCGGCTCACACCAAATGGCGTGCTCTGCGTGAGTCTGAAGATT
CACGTTATCTTGGTTTGACCACCCCTCGTTTCCTGTTGCGCTTACCTTACTCTACTGTTGAAAACCCCAT
TAAAAACTTCAACTACTACGAGGATGTCAGCCGGAATCACGAGCATTTCTTGTGGGGCAACACCGCATTC
CTGCTAGCGTCCTGCCTGACCGACAGCTTCGCCAAGTACCGTTGGTGCCCGAATATTATTGGGCCGCAAA
GTGGCGGCACGGTTCACGATCTCCCGGTTCATCTCTATGAAGCGATGGGGCAGATTCAGGCCAAAATCCC
AACCGAAGTTCTGATCACTGACCGTCGTGAGTTTGAACTGGCGGAAGAGGGCTTTATCACCCTTACCATG
CGTAAAGGCAGTGATAACGCCGCATTCTTCTCGGCGAATTCGGTGCAAAAACCAAAAGTCTTCCCGAATA
CCCGCGAAGGGAAAATGGCAGAAACCAACTACAAGTTGGGCACGCAACTGCCGTACATGTTTATCATCAA
CCGCCTTGCGCACTACATCAAAGTGCTCCAGCGCGAGCAGATTGGTTCATGGAAAGAACGACAGGATCTG
GAGCGCGAGCTCAATATCTGGCTCAAGCAGTACATTGCCGATCAAGAAAACCCACCAACGGATGTTCGTA
GCCGTCGTCCTCTGCGTTCAGCGCAAATCCAGGTACTGGATGTTGAAGGTGATCCGGGCTGGTACCAGGT
TGCGATGCAGGTTCGCCCGCATTTCAAATACATGGGGGCGAGCTTCGAGCTGTCACTGGTTGGCCGTTTG
GATAAGGAATAA
 Primer design