SecReT6
Protein ID: 170022642
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0389
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]422127..423947 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB1JJP3
KEGG IDypy:YPK_0389
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-200, Aligned region: 3..606
Protein Sequence: 606 a.a.     [Download]
>gi|170022642|ref|YP_001719147.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSVHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPDVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGAPKGRGRGHGRVYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAE
ENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLL
DKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGEL
YLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|170022262|ref|NC_010465.1|:422127-423947 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTGTTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAACTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACGCAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAACGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAGTATTTTTGCTTCCCTGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCGGACGTGAAAGTCCGCTCCACCACACTGCGGATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
TCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGCTCCTAAGGGGCGCGGCCGGGGTCATGGCAGGGTGTACACCTCGTTTGAGAGCT
TCCACCATCAGATCGAACACTCGCAAGAAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATT
ATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAA
GAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCA
ATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTA
TCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCTCTAATATGTCGTTGAACTACATGTCCTTACTG
GATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCTGCCA
GGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGG
CTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGGAGCAAGGGGCCTTTAGCTCTGAAGGCGAGCTT
TATCTCTTTAGCACGGTATTAGCTCGCTTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAA
AAGTCATCAATCTTGATAATCAGGAATGTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTA
A
 Primer design