SecReT6
Protein ID: 170022643
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0390
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]423911..424981 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB1JJP4
KEGG IDypy:YPK_0390
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.00E-93, Aligned region: 32..342
Protein Sequence: 356 a.a.     [Download]
>gi|170022643|ref|YP_001719148.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MAGTDRSTCTDVSVVEDVSGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPANEAIRFKST
ASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFNHRLLTL
LHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVS
HCFNLPDITLHSWQLRKVDIAPSQQNRLGMRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLCINKLT
REQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDPEQKPSV
TIGVME
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|170022262|ref|NC_010465.1|:423911-424981 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGGTTGAGGCAA
GACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTTTCAATTGGTCGAATTGCTCAACCAATT
GGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCCAATGAAGCCATCCGTTTTAAATCGACC
GCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACACCTCCGCCCGAGGTCAATTTGAGCTAG
AGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACCAGGATATTACCTCGATTCGTTAGCGTG
GGAGGATGCGCAGAATGAGAACCGGTTGACGGATTTCATGAACGTATTCAATCACCGCCTGTTAACGCTA
CTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTGACAATGGCGGTGATGATGCATTTTCAC
AACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCGCAATAAATTGCAGATCAATCACAGCAA
AATGCTGGCTTATGCAGGGCTGCTGGCTAGCCCCGGCAGAGCACCTGAAGTAATTTGCAGCCTTGTCTCA
CATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGCTACGCAAGGTGGATATTGCCCCCTCAC
AGCAGAATCGCTTGGGGATGAGGGTGAAAGTCCGTGGCAAGAAATATGATGAAAAGTCAGTGCTTGGCGT
TAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAATTTTTGTTGTGCATCAATAAGCTGACG
CGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACGCCTCGTTAGTGATGTTTGTCGCCTTCA
TTATGCGCGATCAATTCGCGTGGGATTTACGTCTTGGGTTGGCCGAGCAACAGGTGGGCGGGATGGTTCT
GGGAACCGAGCAAAATAGCCTCTTGGGCTGGACCAGTATCCTCGGCGATCCCGAACAGAAACCCAGCGTA
ACGATTGGTGTAATGGAATAA
 Primer design