SecReT6
Protein ID: 170022644
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0391
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]425107..426423 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDB1JJP5
KEGG IDypy:YPK_0391
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0056, Aligned region: 34..100
FHA [PF00498], Evalue: 0.0056, Aligned region: 224..239
Protein Sequence: 438 a.a.     [Download]
>gi|170022644|ref|YP_001719149.1| FHA domain-containing protein [Yersinia pseudotuberculosis YPIII]
MDKKQPTLSLRVVNSDKLESGKQASSLFHAQGGSVGSDGSHHWSIQDQGGNISPSQFAIEWRDGSFCLRL
LNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVIKSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEG
EPLASPHHQQDSRLAATVSHNFSHDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPK
DSAMDQAFIDLPQISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKT
LKATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAVAESLDNLRLH
HQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMYKNYYNELASSRQQGFEKLFGE
VYEQAYDRALRQGMKDSE
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|170022262|ref|NC_010465.1|:425107-426423 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGATAAAAAACAACCAACGCTGTCATTGCGGGTCGTCAACAGCGATAAATTAGAGAGTGGCAAACAAG
CCAGCAGCCTGTTTCATGCGCAAGGGGGCAGTGTCGGCAGTGACGGTAGCCATCATTGGTCGATTCAGGA
CCAAGGCGGCAATATCAGCCCGTCACAGTTTGCTATCGAATGGCGTGATGGCTCTTTCTGCCTGCGGTTG
CTGAATGGCTCTCTGAACATTAATCATTCGATGCTAACACCCAATTCGGGTTTCGTTCGCCTACAGCAAG
GGGATGAAATGACGTTGGGTAATCTGGTGATCAAAAGCCATATCAGCCGTTCTGCTGCCGATATGATCGA
TCCACTGATGGTGTCACCAGAGTCACTGGTATCGAGTTACAGCAACCCGATGGATGCCATGATGGAGGGG
GAGCCGTTGGCCTCGCCTCATCATCAGCAAGACAGCCGGTTAGCCGCGACGGTTAGCCATAATTTCAGCC
ATGATCCATTACGGGTATTGGAAACGGAAAGCCTGACTACGCAAGGCCATGACGCCGTGATATCTGATGC
TGATCACTCTCTACAGCAGGACCGATACCGTAACCCACTTTTCTCTTCCCCGCTCTCTGATACCCCCAAG
GACAGTGCTATGGATCAGGCGTTTATCGATCTCCCGCAGATCAGTACCTTTCTTAACGGTAAACAAGCGG
GGGGCAAACCAGAAGGACTCAATAACCAAATGGAACAACATCACGTTGCCATTACGCCGCTGATGCGTGG
TTTTGACGCTCAACTCCCGATCCGCAACAGCCAGGAAGCTCACGATTTCCTTGAAGAGGCGGGTAAAACA
CTCAAAGCGACAATCGAAGGTCTGCTCGCCTTACAACGCAGCCAACATGGCTTGCGTGATAAGCACTTAC
GGCCGATTGAAGATAATCCATTGCGTCTGAATATGGATTACGACACCACCCTCAACTTGATGTTTGCCGA
TCAAAAAAGCCCGGTTCATCTTTCAGCGCCCGCCGCCGTGGCCGAAAGCCTGGATAACCTGCGTTTGCAT
CATCAGGCCAATCAACAGGCGATTACGCAAGCCTTGAACACCATGTTGGAAGCCTTCTCCCCTGAGCGTT
TACTGACGCGTTTTACCCATTATTTGCGCAGTAATGAGCGGCAAGAGCAGGACTCCGCCTGGGCGTGGGA
TATGTACAAAAACTACTATAACGAGCTGGCCTCCAGCCGCCAGCAAGGTTTTGAAAAACTGTTTGGCGAA
GTGTATGAGCAAGCCTATGACCGGGCCTTACGTCAAGGCATGAAGGATAGCGAGTAA
 Primer design