SecReT6
Protein ID: 170022645
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0392
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]426423..426968 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDB1JJP6
KEGG IDypy:YPK_0392
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-35, Aligned region: 17..174
Protein Sequence: 181 a.a.     [Download]
>gi|170022645|ref|YP_001719150.1| putative lipoprotein [Yersinia pseudotuberculosis YPIII]
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQAADQPSTVRLTLLSDRDTNPNEKGE
AAPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIA
HYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEEE
 
Nucleotide Sequence: 546 bp     [Download]
>gi|170022262|ref|NC_010465.1|:426423-426968 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAACAACGCCAGAGGCTATCTCCTGACGTGGGCATTATGTGTAGTGTTCCTATTGTCTGGGTGCAGCG
GTGCATGGGAAGCCACTAAAAAGGTCGGCAAGGTGGTTATGGACCCCGATATTCCGGTGGGGCAGGCTGC
TGATCAACCCTCAACGGTCAGGCTAACATTGCTGTCCGATCGCGATACCAACCCTAATGAAAAAGGGGAA
GCGGCCCCGACTGAGATAGTGGTGGTGTACCTAAGTGAAAACTCCAAGCTGCTGGCCGCGGATTATGATC
AGCTAAGCAGTGACGCGCTGGAGAAAACGCTGGGTAAGAATTACATCGATCATCAGGAATACACCTTACT
GCCCGATCAATTCAAGGCGCTGGACCCTATCAAACTGGAAGAGAAAAACAGCTATCTGGGGGTGATTGCT
CACTATGCCGATGCTAACCGCAGTGAATGGAAGAAGATCATCAAAATAAAAGGGATCGGCCATAACTACC
AGGTTTTGGTCCATGTCAGATCAAACGATGTCGATCTAAGGAAAGAGGAAGAATAA
 Primer design